KEGG   Blastomonas fulva: B5J99_08560Help
Entry
B5J99_08560       CDS       T05612                                 

Definition
(GenBank) methyltransferase
  KO
K09846  demethylspheroidene O-methyltransferase [EC:2.1.1.210]
Organism
bfw  Blastomonas fulva
Pathway
bfw00906  Carotenoid biosynthesis
bfw01100  Metabolic pathways
bfw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfw00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    B5J99_08560
Enzymes [BR:bfw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.210  demethylspheroidene O-methyltransferase
     B5J99_08560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_12 Methyltransf_25 MTS Methyltransf_23 Methyltransf_31 ACP_syn_III_C SelB-wing_1
Motif
Other DBs
NCBI-ProteinID: ASR53413
UniProt: A0A222X5X5
Position
1833800..1834786
Genome map
AA seq 328 aa AA seqDB search
MFDIIAGFTYSQTLFACVESGIVARLQQGAAASAELGTRARLGPDATRRLLRAAAALGLI
ERVGDDLWMLGEQGVALVGNPGAIAMIRHHHLLYADLADPLSLLRGERTVPGALAGYWPY
ALGDGSEGEDQAAVSPYSQLMAASQPMVADQVVHAWRFDRHRRMLDVGGGAGAFIAAVAK
VAPRLDFGLFDLPAVTAIGARQLGEQGIKVNPHPGDFRNDAIPTGYDLITLIRILHDHDD
ELAQALLIKVRASLKPGDTLLIAEPMAGTSGAEAMADAYFGFYLLAMGSGRARTPQEIGA
MLTRAGFASWRERPTGLPIVTRVIAATA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
ctgttcgatatcatcgccgggttcacttattcgcagaccctgttcgcctgtgtcgaaagc
ggcatcgtcgcgcggctgcagcagggggctgcggcttcggctgagctgggcacgcgggcg
cgactcgggcccgatgcgacgcgccggctgctgcgtgcggcggcggcgctggggctgatc
gagcgcgtcggcgacgatctgtggatgctgggcgaacagggcgtcgctttggtcggcaat
cccggtgcgatcgcgatgatccgtcatcaccacctgctctacgccgaccttgccgatccg
ttgtcgctgctgcgcggcgagcgcaccgtgcccggcgcgctcgcaggctattggccctat
gcgctgggcgatggcagcgagggtgaggatcaggcagcggtgtccccctattcgcagctg
atggcggcatcgcagcctatggtcgccgatcaggtggtgcatgcctggcgattcgaccgg
cacagacgcatgctcgatgtcggcggcggggcaggggcgttcatcgcggcggtggccaag
gtcgcgccaaggctcgacttcgggctgttcgatctgcccgcggtcaccgcgatcggcgcg
cggcagctgggcgaacaggggatcaaggttaaccctcatcccggcgatttccgcaacgac
gcgattcccacgggctatgacctgatcacattgatccgaatcctgcacgatcatgatgac
gagctggcccaggcgctgctgatcaaggtccgcgcctcgctcaagcccggagacacgttg
ctgattgccgaaccgatggcgggaaccagcggcgcagaggcgatggcggacgcctatttc
ggcttctatctgctcgccatgggctcgggcagggcccgtactccgcaggaaatcggcgcc
atgctgacccgcgcaggctttgcatcgtggcgggaacgacccaccgggctgcccatcgtc
acccgcgtgattgccgctaccgcctga

DBGET integrated database retrieval system