KEGG   Blastomonas fulva: B5J99_09200Help
Entry
B5J99_09200       CDS       T05612                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
bfw  Blastomonas fulva
Pathway
bfw00780  Biotin metabolism
bfw01100  Metabolic pathways
Module
bfw_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:bfw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    B5J99_09200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bfw01007]
    B5J99_09200
Enzymes [BR:bfw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     B5J99_09200
Amino acid related enzymes [BR:bfw01007]
 Aminotransferase (transaminase)
  Class II
   B5J99_09200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ASR51615
UniProt: A0A222X010
Position
complement(1965698..1966837)
Genome map
AA seq 379 aa AA seqDB search
MATPAFETHAAQLESLKRDSRLRALAPRSGKDFASNDYLGLAGSTLLHDALREGMALGLP
AGSGGSRLLRGNHAAHEALEADAAAHFGSQSALFFATGFAANAALFATLPQRGDLVVHDS
LIHASAHDGMKLGRAETRAARHNDAQAFDDVITAWRAEGGSGQVWIAVESLYSMDGDCAP
LADLAEVAARHDAALVIDEAHATGVFGPCGAGLAHGLAGQPNVITLHTCGKALGCEGALI
CAPKVVTDFLVNRARPFVFSTAPSPLIAHMVRRAIAIVAAHHDWRDELFARVAEARRLLA
PRLGAQGGTSQILPVIIGDDARTMRIAASLQRQGFDIRGIRPPTVPPGTARLRISITRNV
SMGDIGALSESLDRIMIPA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttggccacgccagccttcgaaacccatgccgcgcagctcgaatccctgaaaagggattcg
aggctgcgtgcgcttgcgccccgttcgggcaaggattttgcctcgaacgattatctggga
ctggcaggatcgacgctgctgcacgatgccttgcgcgaaggcatggcattgggtctcccc
gcaggatcgggcggatcgcggctgctacgcggaaaccatgcggcgcatgaggcgctcgaa
gccgatgccgcggcgcatttcggcagccagtccgcactgttcttcgccaccggctttgcc
gccaacgcggcgctgttcgccacgctgccgcagcgcggcgatctggtggtgcatgacagc
ctgatccacgcatccgcgcacgacggcatgaaactgggccgcgccgaaacccgcgccgct
cggcacaacgacgcgcaggcgttcgacgacgtcatcaccgcctggcgcgccgaaggcgga
tccgggcaggtctggatcgcggtcgaaagcctctacagcatggacggcgactgcgcgccg
ctggccgatctggccgaggtcgccgcgcggcacgatgcggcgctggtcatcgacgaggcc
cacgccaccggggtgttcggcccttgcggcgccggcctcgcgcacggtcttgccggacag
ccgaatgtcatcactttgcacacctgcggcaaggcgcttggctgcgaaggcgcgctgatc
tgcgcgcccaaggtggtcaccgatttcctcgtcaaccgcgcgcggcccttcgtgttctcg
accgcgccctcgccgctgatcgcgcacatggtgcgccgtgcgatcgcgatcgtcgcagcc
catcacgactggcgcgacgagctgtttgcccgcgttgccgaggcgcggcgcctgctcgcc
ccgcggctgggcgcgcagggcggcaccagccagatcctccccgtgatcatcggcgatgat
gcccgcaccatgcggatcgccgccagcctgcagcgccagggcttcgacattcgcggcatc
cgcccacccaccgtgccgcccggcaccgcgcgcctgcggatttccattacccgcaatgtc
tcgatgggtgatatcggcgcgctatccgaatcactcgacaggatcatgatccccgcatga

DBGET integrated database retrieval system