KEGG   Blastomonas fulva: B5J99_17765Help
Entry
B5J99_17765       CDS       T05612                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
bfw  Blastomonas fulva
Pathway
bfw00790  Folate biosynthesis
bfw01100  Metabolic pathways
bfw02020  Two-component system
Module
bfw_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bfw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B5J99_17765
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B5J99_17765
Enzymes [BR:bfw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     B5J99_17765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: ASR53076
UniProt: A0A222X3W1
Position
3757319..3758965
Genome map
AA seq 548 aa AA seqDB search
MTMTIDRRLLIKAGTFGLAALSIPGAAQALFAGRGFTHGVASGEPSGNSVLLWTRYVADS
DARLTAELSPTPDFARPVGGGSVTASAARDHIAKLTVTGLKPDSWYFYRFVAADGSTSPV
GRTRTLPVGEAAGFNIGVFSCSNLPFGWFNGYAHAAARNDLDLAVHTGDYVYEYGLDVYP
TRGQALPGRSVQPDHEMVTLADYRLRYASYRLDADLQRLHQVVPMIAMWDDHEIANDSYR
DGAQNHQSDSEGDYATRRRIAEQVYREWMPVADLAPADPLWTSYQIGNLATLIRTESRLS
GRDKPAELADAFAGGGDIAAALARFRDEKWVDPARRMLGDDQARWLGDQFKASKASGTRW
QVWAQQCVMGSMKLPLETGDWVPRDAPAIVRSRSAAGLAASKAGLPFNMDAWDGYPVQRE
ALLQSAQAADADLVVLSGDSHNGWGFDLDAGGKPAGVEFAGHSISSPGFEAYAPTIAPAD
VAGALVRGNPQLKWADTSSRGYMTLQLTQQSATAHWHKLRTIRERSTDLAGSSSLSVLPG
RRTIAMPG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacaatcgaccgcaggctgctgatcaaggcgggcaccttcgggcttgccgca
ttgtccattcccggtgcggcgcaggcgctgtttgcagggcgcggcttcacccatggcgtg
gcgagcggcgagccttcgggcaattcggtgctgctgtggacgcgctatgtcgcggacagc
gatgcacggctgaccgccgagctctcccctacccccgatttcgccaggcctgtgggcggc
gggtcggtaactgccagcgccgcgcgcgaccatatcgccaagctcaccgtcaccgggctc
aagcccgacagctggtatttctatcgcttcgtggcggcagatggcagcacgtcaccggtc
ggccgcacccgcacgctgccggtgggcgaggccgcaggcttcaacatcggcgtgttttcc
tgctccaacctgccctttggctggttcaacggctatgcccatgccgccgcgcgcaacgac
ctggatctggcggtgcacaccggcgactatgtctatgaatacggcctcgacgtgtacccc
acgcgcggtcaggcgctccccgggcgcagcgtccagcccgatcacgagatggtgacgctg
gccgattaccggctgcgctatgccagctaccggctcgatgccgatctgcagcggctgcac
caggtggtgccgatgatcgcgatgtgggacgaccacgagatcgccaatgacagctatcgc
gatggcgcgcagaaccatcagagcgacagcgaaggcgattatgcgacccgccgccgcatc
gccgaacaggtctatcgcgagtggatgccggtcgcagatctggcgcccgccgaccccttg
tggaccagctaccagatcggcaaccttgccacgctgatccgcaccgaaagccgcctgtcg
ggccgagacaaacccgccgagctcgccgatgcgtttgccggtggcggcgacatcgctgca
gcactggccaggttccgcgacgaaaaatgggtcgaccctgcccgccgcatgctgggtgac
gatcaggcgcgctggctgggcgaccagttcaaggcgtccaaggcgtcaggtacccgctgg
caggtgtgggcgcagcaatgcgtgatgggatcgatgaagctgccgctcgaaaccggcgac
tgggtgcccagggacgcacccgcgatcgtgcgcagccgatcggctgcggggcttgcagcg
agcaaggccggcctgccgttcaacatggacgcatgggatggctaccccgtccagcgcgag
gcgctgctccagtccgcgcaggccgcggacgccgatctggtcgtgctgtcgggcgacagc
cacaatggctggggcttcgatctggatgcgggcggcaagcccgccggggtcgagtttgcc
ggtcattcgatcagctcgccggggttcgaggcctatgcgccgacgattgcccccgccgat
gtcgcaggcgcactggtgcgcggcaatccgcagctcaaatgggccgataccagctcgcgc
ggctacatgacgctgcagctgacccagcaaagcgccaccgcgcactggcacaagctgcgc
accattcgcgaacgcagcaccgatctggccggaagcagcagccttagcgtccttcccgga
cggcggacgatcgcgatgcccggctga

DBGET integrated database retrieval system