KEGG   Bacillus flexus: BC359_02325Help
Entry
BC359_02325       CDS       T04803                                 

Definition
(GenBank) L-glutamate gamma-semialdehyde dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
bfx  Bacillus flexus
Pathway
bfx00250  Alanine, aspartate and glutamate metabolism
bfx00330  Arginine and proline metabolism
bfx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BC359_02325
   00330 Arginine and proline metabolism
    BC359_02325
Enzymes [BR:bfx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BC359_02325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh YCII LuxC
Motif
Other DBs
NCBI-ProteinID: AQX53246
UniProt: A0A1S6Z6G5
Position
453575..455143
Genome map
AA seq 522 aa AA seqDB search
MTITTKPSVFKNEPFTDFTVEANKVAMEKALEKVKGKLGGTYPISIGSETIDTGDYIVSI
NPGSKDDVIGRVSKGTTALAEQAMQQALTTFEMWKNVSPAERADYLFKAADLMRQRKHEF
SAMLVYEVGKNWAEADADTAEAIDFMEFYAREMLRLSETHINQPLTPVDGEKTRMAYIPL
GVGVIISPFNFPLAIMAGTTVAAIVSGNTVILKPADSAPVIAAKFVELMKEVGLPEGVLN
FVPGDGIEVGEYLVEHPKTRFVSFTGSREVGCRIYERASKVQSGQIWLKRVIAEMGGKDG
IVVDETADLDAAADGIVAAAFGFQGQKCSAGSRAIIVESVYDEVVEKVVERTKKLSIGLP
EENHAVGPVIDQKAYNKILSYIETGKGEGTLLTGGGPAEGNGFYIEPTVFGDVSPQARIM
KEEIFGPVLAMAKAADWKEAIEIYNDTDYGLTGGFFSRDENRISTALNEMHCGNLYINKK
CTGALVGVHPFGGFNMSGTDSKAGGYDYLLLFTQGKMTARKI
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgacaattacaacaaaaccatctgtatttaaaaatgaacctttcactgattttacagtt
gaagcaaataaagtagcgatggaaaaagcgttagaaaaagtaaagggtaagctaggggga
acctacccaatttcaattggtagcgaaacaattgatacaggagattatattgtgtcaatc
aatcctggaagtaaagatgacgtcattgggcgcgtgagcaaaggaacaacggctttagcg
gagcaagcaatgcaacaagcgttaacaacgtttgaaatgtggaagaacgtttcaccggct
gagcgtgcggactatttatttaaagcagcggatttgatgcgtcaacgtaagcatgaattc
tctgcgatgctcgtttatgaagtagggaaaaattgggctgaggcagatgcagatacagca
gaagcaattgattttatggagttttatgcaagagaaatgcttcgccttagcgagacgcac
attaatcagccattaacgcctgtagatggtgaaaagacgcgaatggcgtatattccactt
ggagtaggggtgatcatctcaccatttaatttcccactcgcaattatggcaggaacgacc
gtagcggcaattgtatcggggaacacagttatcttaaaaccagctgattcagctccggtt
attgcggctaaatttgtggagcttatgaaagaagtaggcttaccggaaggagtcttaaac
tttgtgccaggagacggtattgaagtaggcgaatacttggttgagcacccaaaaacacgc
tttgtttccttcacgggttcacgtgaagttggttgtcgtatttacgaaagggcgtctaaa
gtacagtctggacagatttggttaaagcgtgttattgctgaaatgggcggtaaagatgga
attgtagtagatgaaacagctgatttagatgcagctgctgatggaattgtggcagcagca
ttcggcttccaaggacaaaagtgttcagcaggttctcgtgcaattatcgtggaatctgtt
tatgatgaagtggtagaaaaggtcgtagaacgtacgaaaaagcttagcattggactgccg
gaagaaaatcatgcagtgggtccagtaattgatcaaaaagcatacaataaaatcttgtcg
tatattgagactggaaaaggtgaaggaacgcttctaacaggcggtggtccggctgaaggg
aatggcttctatatcgaaccaactgtatttggagatgtgagtccgcaggcacgcatcatg
aaagaagaaatctttgggcctgttcttgcgatggcaaaagcagctgactggaaagaagca
attgagatttataacgatacagattacgggttaacgggcggattcttctctcgcgatgag
aatcgtatttcgactgctctaaatgaaatgcactgcggaaacttgtacattaacaaaaaa
tgtacgggtgcgttggtaggagtacatccttttggtggtttcaatatgtcaggaacggac
tctaaagcgggtggctatgactatctacttctatttacacaagggaaaatgacagctaga
aagatttaa

DBGET integrated database retrieval system