KEGG   Bacillus flexus: BC359_05710Help
Entry
BC359_05710       CDS       T04803                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bfx  Bacillus flexus
Pathway
bfx00071  Fatty acid degradation
bfx00072  Synthesis and degradation of ketone bodies
bfx00280  Valine, leucine and isoleucine degradation
bfx00310  Lysine degradation
bfx00362  Benzoate degradation
bfx00380  Tryptophan metabolism
bfx00620  Pyruvate metabolism
bfx00630  Glyoxylate and dicarboxylate metabolism
bfx00640  Propanoate metabolism
bfx00650  Butanoate metabolism
bfx00900  Terpenoid backbone biosynthesis
bfx01100  Metabolic pathways
bfx01110  Biosynthesis of secondary metabolites
bfx01120  Microbial metabolism in diverse environments
bfx01130  Biosynthesis of antibiotics
bfx01200  Carbon metabolism
bfx01212  Fatty acid metabolism
bfx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BC359_05710
   00630 Glyoxylate and dicarboxylate metabolism
    BC359_05710
   00640 Propanoate metabolism
    BC359_05710
   00650 Butanoate metabolism
    BC359_05710
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BC359_05710
   00072 Synthesis and degradation of ketone bodies
    BC359_05710
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BC359_05710
   00310 Lysine degradation
    BC359_05710
   00380 Tryptophan metabolism
    BC359_05710
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BC359_05710
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BC359_05710
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BC359_05710
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bfx04147]
    BC359_05710
Enzymes [BR:bfx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BC359_05710
Exosome [BR:bfx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC359_05710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AQX53843
UniProt: A0A1S6Z8I9
Position
1109902..1111089
Genome map
AA seq 395 aa AA seqDB search
MSQTEVVIVSAVRTAIGSFGGSLQNVSAPTLGGVVIKEALNKVGIAANDVDEVIMGNVLQ
AGLGQNPARQAALAAGLPETVSSLTINKVCGSGLKAVHLATQAILAGDAEVIVAGGMENM
SQAPYLLKNARNGFKMGDQKVVDSMIQDGLWCAFNDYHMGITAENLCDKYSITREEQDSF
AAASQQKAEAAIESGRFQDEIVPVEVPGRKGQVTIFDRDEFPRAGTTAESLGKLRPAFKK
DGSVTAGNASGINDGAAAVVVMSRQKADELGLTPLVTIKSNASAGVDPSIMGIGPVSAVK
KALEKAAVSLEDVELVEANEAFAAQSIAVDRELKFNQETLNVNGGAIALGHPIGASGTRV
LVSLIHEMQKREAKLGLATLCIGGGQGVATLVERP
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaacagaagtggtcattgtaagcgctgttagaacggcaatcggcagctttggg
ggaagcttacaaaatgtttctgcaccaactttaggtggagtagtcattaaagaagcacta
aataaagtaggaatcgcagcaaatgatgtagatgaagtaattatggggaacgtcttgcaa
gcaggattaggtcaaaacccggctagacaagcagctctcgcagcgggtttaccagaaaca
gtttcttcattaacaatcaataaagtgtgtggatcaggactaaaggcagttcatcttgca
actcaagcaatccttgctggtgatgctgaagttatcgtagcgggtggaatggaaaatatg
agccaagcgccatatttattaaagaatgctcgcaatggattcaaaatgggagatcaaaaa
gtcgttgatagtatgattcaagatggactatggtgtgcttttaacgattatcatatggga
attacagctgaaaatttatgtgataaatatagcattacgcgtgaagaacaagactctttt
gctgctgctagtcagcaaaaagcagaggctgcaatcgaatcaggacgattccaagatgag
attgttccggtagaagtaccaggacgcaaaggtcaagtaaccatttttgatcgcgatgag
tttccacgtgctggtacaacagcagaaagcttaggtaagttacgtcctgcatttaaaaag
gatggttctgtaacagctggaaatgcttctggtattaatgatggtgcggcagcggttgtt
gtgatgagccgtcaaaaagcagacgaactaggcttaacacctttagtaacaattaaatcc
aatgcaagtgctggtgttgacccaagcattatgggaatcggcccagtaagcgctgtaaaa
aaagcattggaaaaggcagcggtatctttagaagatgttgaattagtagaagcaaacgaa
gcttttgcagcacagtcaattgctgttgatcgtgagcttaaatttaaccaagaaacatta
aatgttaatggtggagcaatcgcactaggtcatccaataggagctagtggaactcgcgtg
ttagtttctcttattcatgaaatgcaaaaacgtgaagcgaagctaggccttgcaacgtta
tgtattggtggcggacaaggggttgctacattagtagaacgtccataa

DBGET integrated database retrieval system