KEGG   Bacillus flexus: BC359_09870Help
Entry
BC359_09870       CDS       T04803                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
bfx  Bacillus flexus
Pathway
bfx00860  Porphyrin and chlorophyll metabolism
bfx01100  Metabolic pathways
Module
bfx_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bfx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BC359_09870
Enzymes [BR:bfx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     BC359_09870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase
Motif
Other DBs
NCBI-ProteinID: AQX54587
Position
1934738..1936228
Genome map
AA seq 496 aa AA seqDB search
MKKAIPLMVQGTHSDAGKSLLTTAFCRIFAEDGFKTAPFKSQNMALNSYITKDGKEIGRA
QGIQAEAAGVEATTNINPVLIKPTREYEAQVVVHGVPLQNMYAYEYRKDFFETGREIITK
SYEELASEYEYIVIEGAGSPAEINLNDRELVNMRVADIAQSPVILVGDIDKGGVFASLVG
TIQLLPKEHKSKVVGVIINKFRGDLSLLQPGLDWFEEYTGLPVLGVVPYLDDVEIDAEDS
LALTTYPTLPNPAKELDVAVISYPRMSNFTDLDPIRFEDDCHVRLVTKPSQLGTPDLIIL
PGSKNTLEDAKYLYETGLAEAILTKKNKVDIAGICGGYQILGEVISDPNEVESTQKSVKG
LGLLPIETVMKTKKRTERVTGRAILHDESYQIEGYEIHMGETTSTKPTVHFAELNGIKEG
AVFGRVIGTYIHDVFHNDGFRRAYLNDIRQQKGLVPIKKTFNSRARKEESFQKLAAHVRK
AIDMKQIYEIMSEYKK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcaattcctcttatggttcaaggaacgcactcggacgctggaaaaagttta
cttacaactgctttttgccgaatttttgcagaagatggtttcaaaacagcgccgtttaaa
tcacaaaatatggcacttaactcttatattacaaaggatggaaaagagattggacgtgct
caaggaattcaagctgaagctgctggagtggaagcaacgaccaatataaatccggtttta
atcaaaccgacaagagagtatgaggcgcaggtcgtcgttcatggtgttcctttgcaaaat
atgtatgcgtacgagtataggaaagatttctttgaaaccggacgtgagattatcaccaaa
tcgtatgaagagcttgcttctgagtacgagtatattgtcattgaaggagcagggagtcct
gctgaaattaacttaaacgaccgtgaacttgtgaatatgcgagtagctgatattgcacag
tctcccgttattttagtaggagatatcgataagggaggcgtttttgctagcttagtagga
acaattcagctgcttccaaaagagcataagtcaaaagtggtaggtgtgattattaataaa
tttcgaggtgacttgtcgctgttgcaaccagggcttgattggtttgaagagtatacggga
cttcctgttctaggcgtcgttccttatctggatgatgtggagattgatgcagaagattca
cttgctttaactacgtaccctactcttccaaatccagctaaagaacttgatgttgccgtt
atttcttatcctcgcatgtcgaactttacagatctagatcctattcgttttgaagatgat
tgccacgtaaggcttgtgacaaaaccttctcagcttggaacgcctgatttaatcatttta
cctgggagcaagaatacgttagaagacgcaaagtacttgtatgaaacgggcttagcagaa
gctattttgacaaagaagaataaggtggatattgctggaatctgcggtgggtatcaaatt
ttaggtgaagtgataagcgacccaaatgaagtggaatcaacccaaaaatctgttaaaggg
ctaggtcttttacctattgaaactgtaatgaaaacaaagaagcgaacagaacgggtaacg
ggaagggctattttacacgatgagtcctatcaaattgaaggttacgaaattcatatgggc
gaaacaacgtctaccaagccaactgtacattttgctgagctaaatggtataaaagaagga
gcagtttttggtcgcgtcattggtacatacatacatgatgtttttcataatgatggcttt
cgacgtgcatatttaaacgatattcgacagcaaaaaggattagtgccgattaagaaaacg
tttaatagtagggcgcgaaaggaagagtcttttcaaaagctggctgcacatgtacgaaaa
gcaattgatatgaaacaaatttatgaaatcatgagtgaatataaaaagtaa

DBGET integrated database retrieval system