KEGG   Bordetella flabilis: BAU07_00545Help
Entry
BAU07_00545       CDS       T04592                                 

Definition
(GenBank) bacterioferritin
  KO
K03594  bacterioferritin [EC:1.16.3.1]
Organism
bfz  Bordetella flabilis
Pathway
bfz00860  Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:bfz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BAU07_00545
Enzymes [BR:bfz01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.1  ferroxidase
     BAU07_00545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ferritin
Motif
Other DBs
NCBI-ProteinID: ANN75812
UniProt: A0A193G760
Position
117500..117976
Genome map
AA seq 158 aa AA seqDB search
MQGDKTVIQFLNKQLTNELTAINQYFLHARMLRHWGLNKLGKHEYEESIGEMKHADRLIE
RIFMLDGLPNLQDLHKLLIGENVPEILSCDLKLEQGAQATVKEAIAYCESVRDYVSRDLF
QDILDDTEEHIDYLETQIGLVDQVGLQNYLQSQMEVSD
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcgataaaaccgtcatccagtttctcaacaagcaactcaccaatgaactgacg
gcgatcaaccagtattttctccacgcgcgcatgttgcgccactggggtctgaacaagctg
ggcaagcacgaatacgaagagtccatcggcgaaatgaaacacgccgaccgtctcatcgaa
cgcatcttcatgctggatggactgcccaatcttcaggacctgcacaaactgttgatcggc
gagaacgttccggagatcctttcctgtgatctgaagctcgaacagggcgcgcaggcaacg
gtgaaggaagccatcgcgtattgcgaatcggtgcgtgactacgtgtcccgcgatctcttc
caggatatcctggacgataccgaagagcacatcgattacctggaaacgcagatcgggctg
gtggaccaggtgggcttgcagaactatctgcaaagccagatggaagtgtccgactga

DBGET integrated database retrieval system