KEGG   Bordetella flabilis: BAU07_02360Help
Entry
BAU07_02360       CDS       T04592                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bfz  Bordetella flabilis
Pathway
bfz00071  Fatty acid degradation
bfz00072  Synthesis and degradation of ketone bodies
bfz00280  Valine, leucine and isoleucine degradation
bfz00310  Lysine degradation
bfz00362  Benzoate degradation
bfz00380  Tryptophan metabolism
bfz00620  Pyruvate metabolism
bfz00630  Glyoxylate and dicarboxylate metabolism
bfz00640  Propanoate metabolism
bfz00650  Butanoate metabolism
bfz00900  Terpenoid backbone biosynthesis
bfz01100  Metabolic pathways
bfz01110  Biosynthesis of secondary metabolites
bfz01120  Microbial metabolism in diverse environments
bfz01130  Biosynthesis of antibiotics
bfz01200  Carbon metabolism
bfz01212  Fatty acid metabolism
bfz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bfz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAU07_02360
   00630 Glyoxylate and dicarboxylate metabolism
    BAU07_02360
   00640 Propanoate metabolism
    BAU07_02360
   00650 Butanoate metabolism
    BAU07_02360
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAU07_02360
   00072 Synthesis and degradation of ketone bodies
    BAU07_02360
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAU07_02360
   00310 Lysine degradation
    BAU07_02360
   00380 Tryptophan metabolism
    BAU07_02360
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAU07_02360
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAU07_02360
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BAU07_02360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bfz04147]
    BAU07_02360
Enzymes [BR:bfz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAU07_02360
Exosome [BR:bfz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAU07_02360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANN76115
UniProt: A0A193G8F9
Position
complement(523977..525161)
Genome map
AA seq 394 aa AA seqDB search
MQAREIVICAPVRTPIGAYNGSLKTVPATALGAAVVRETLRRSAIDPAAVDTVVMGNVVQ
AGNRMNPARQAAIGGGMPVSVPALTVNRVCGSGAQAIVSVALEIWAGQARLGIAGGMENM
DMAPYLMPNGRWGARMGDVTAHDSMLRDGLVDAFSGEHSGWHTEDLVARYALTRLEQDEW
SERSQRRFGLAQQEGLFESEVVAVDVPGARKQPRFERDEANRPDTTVAALSALRPAFRAD
GTITAGNAPGLNSGAAAMVIADAAMARDQGLQPLGRLVSYGIAAVEPGMFGLGPVPAIRM
ALQRAGWTLSEVDRFEINEAFAAVPLAVARELGISHDVLNVDGGAIAHGHPIGATGAILV
TRMLHAMQRQRLQRGVVSLCIGGGQGIALALEAC
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaagagaaatcgtgatttgcgcgcccgtacgcacgccgatcggtgcatacaac
ggttcgctcaaaacagttcccgcaacggcgctgggcgctgcggtcgtgcgcgaaaccctg
cgacggtccgctatcgacccggcagccgtcgacaccgtcgtcatgggcaacgtcgtacag
gccggcaatcgcatgaaccctgcgcgccaggcggcgatcggcggcggcatgccggtgtcc
gtccccgccctgacggtgaaccgcgtctgcggttccggtgcgcaggcgatagtctccgtg
gcgctggagatctgggcaggccaggcgaggctcggaatcgcgggcgggatggagaacatg
gacatggcgccctacctcatgcccaacggccgatggggcgcgcgcatgggagacgtcact
gcccatgacagcatgctgcgtgacggcctggtcgacgccttctccggcgagcattccggc
tggcataccgaagacctggttgcccgctacgccctgacccgtctcgaacaggacgaatgg
tccgagcgctcgcagcgccgcttcggcctggcccagcaggagggcctgttcgaatccgag
gtcgtcgccgtggacgtacctggcgccaggaagcagccacggttcgagcgcgacgaggcg
aatcggccggataccacggtggcggcattgtcggcactgcgtccggcgttccgggcggac
ggcaccattaccgccggcaatgcgccaggcttgaacagcggcgccgcggccatggtgata
gccgacgccgcgatggcccgtgaccagggactgcagcccctgggccggctggtgtcctac
gggattgcggccgtcgaacccggcatgttcggcctgggccccgttccggccatacggatg
gcgctgcagcgcgccggctggacattgagcgaggtcgaccgctttgaaatcaacgaggca
ttcgccgccgttccgctcgccgtggcgcgcgaattgggcattagccacgacgtattgaat
gtcgatggcggcgctatcgcgcatggtcatccgatcggggcgaccggcgcaatactcgtc
acccgcatgctgcatgccatgcagcggcaacgccttcagcgcggcgttgtcagcctgtgc
atagggggcggccaaggtatcgccctcgcgctggaagcctgctga

DBGET integrated database retrieval system