KEGG   Bordetella flabilis: BAU07_03230Help
Entry
BAU07_03230       CDS       T04592                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bfz  Bordetella flabilis
Pathway
bfz00051  Fructose and mannose metabolism
bfz01100  Metabolic pathways
bfz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BAU07_03230
Enzymes [BR:bfz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BAU07_03230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ANN76256
UniProt: A0A193G9V4
Position
725915..726688
Genome map
AA seq 257 aa AA seqDB search
METMQLKKGEIVSASLKKMESDLRSEKMPLREAVAETCRILFAFGHDSGLSGQITARAET
AGTYWTQRLGLGFDEITSDNLLLVDQDLNVLKGEGMPNPANRFHSWLYRARPDINCIVHS
HAPHASALAMLEVPLTISHMDTCVLYDQVAFLGEWPGIPVGNEEGEIISGALGNKKAILL
SHHGLLVCGASVEEACVLGVMFERAARLQLLAMAAGEIQPIPHDLGAEAQKWVSTPRRYE
ATFAYYSRRARRELPAL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccatgcaactcaaaaagggcgaaatcgtcagcgcttcgctcaagaaaatggaa
agcgacctgcgctcggaaaagatgccgctgcgcgaagcggtcgccgagacttgccgcatc
ctcttcgcgttcgggcacgactccggcctgtccggccagatcaccgctcgcgcggagacg
gcgggcacctactggacgcagcgcctcggcctgggtttcgatgaaattaccagcgacaac
ctgctgctggtcgaccaagacctcaacgtgctgaagggcgaagggatgcccaatccggcc
aaccgcttccattcctggctgtatcgcgcgcggccggacatcaactgcatcgtgcactcg
cacgcgccgcacgcatccgcgctggcgatgctggaagtgccgttgaccatctcgcacatg
gatacctgcgtgctgtatgaccaggtcgcgttcctgggcgagtggcccggcattccggtg
ggcaatgaggaaggcgagatcatcagcggcgcgctggggaacaagaaggctatcctgctt
tcgcaccacgggctgctggtgtgcggcgccagcgtagaagaagcctgcgtgctgggcgtg
atgttcgaacgcgcagcgcggctgcaattgctggcgatggccgcgggcgagatccagccg
attccccacgacctgggcgcggaggcgcagaagtgggtcagtacgccgcggcggtacgaa
gccacgttcgcctactactcgcggcgcgcgcgccgggagcttccggcgctttga

DBGET integrated database retrieval system