KEGG   Bordetella flabilis: BAU07_22715Help
Entry
BAU07_22715       CDS       T04592                                 

Definition
(GenBank) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
bfz  Bordetella flabilis
Pathway
bfz00860  Porphyrin and chlorophyll metabolism
bfz00970  Aminoacyl-tRNA biosynthesis
bfz01100  Metabolic pathways
bfz01110  Biosynthesis of secondary metabolites
bfz01120  Microbial metabolism in diverse environments
Module
bfz_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:bfz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BAU07_22715
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAU07_22715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bfz01007]
    BAU07_22715
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bfz03016]
    BAU07_22715
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bfz02048]
    BAU07_22715
Enzymes [BR:bfz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     BAU07_22715
Amino acid related enzymes [BR:bfz01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BAU07_22715
Transfer RNA biogenesis [BR:bfz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BAU07_22715
 Prokaryotic type
   Other AARSs
    BAU07_22715
Prokaryotic defense system [BR:bfz02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BAU07_22715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c Toxin_11
Motif
Other DBs
NCBI-ProteinID: ANN80705
UniProt: A0A193GLG0
Position
5097352..5098764
Genome map
AA seq 470 aa AA seqDB search
MTQTPNSRVRTRFAPSPTGFLHLGGARTALFSWAFARHHGGVFVLRIEDTDVERSTPEAV
QAILDSMDWLGMQPDEGPFYQMQRMDRYREVVAQMLAAGTAYHCYCTPEEVEAMRERARA
QGLKPRYDGTWRPEQGKTLPPVPAGRQPVVRFKNPLTGVTSWNDMVKGPISFDNGELDDL
IIARPDGTPTYNFCVVVDDWDMGITHVLRGDDHVNNTPRQINILRALGATLPEYGHVPMI
LGPDGEKLSKRHGAVNVMEYDKEGYLPEAMVNYLARLGWSHGDDELFTRAQLVEWFDTRH
LSKSASQWDPKKLNWVNAHYLRQMSDADLAAHVAPRLARRGGDPAAADLAAVVGLLKDRA
ETLEQLAEGAMLFCGPFGGVPAELAAQHLTDAAREALRDFARESATSDWSRESLSATIKK
VLAARGIKMPQLAIPLRVAVTGQTQTPAIDAVLALLGKEKVLQRLEAALA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccccgaattcccgcgtccgcacccgcttcgcaccatcgcctaccggcttc
ctgcacctgggcggcgcgcgcaccgcgcttttctcctgggccttcgcccgccaccacggc
ggcgtcttcgtgctgcgcatcgaggacaccgacgtcgagcggtccaccccggaagcggta
caagccatcctcgatagcatggactggctgggcatgcagcccgacgaaggtccgttctac
cagatgcagcgcatggaccgctatcgcgaagtggtggcccagatgctggccgccggtacg
gcctatcactgctactgcacgccggaagaagtggaagccatgcgcgaacgtgcccgcgcg
caaggcttgaagccacgctacgacggcacctggcgccccgaacagggcaagaccctgccg
cccgtaccggcagggcgccagccggtcgtccgcttcaagaacccgctcacgggcgtcacc
agctggaacgatatggtcaagggcccgatcagcttcgacaacggcgaactggacgacctg
atcatcgcgcggccggacggcacgccgacctataacttctgcgtcgtggtcgacgactgg
gacatgggaatcacccacgtgttgcgcggcgatgaccacgtcaacaatacgccgcgccag
atcaatatcctgcgcgcgctgggtgccacactgcccgagtacggccatgtccccatgatc
ctgggcccggacggcgaaaaactgtccaagcgccacggtgcagtgaacgtcatggagtac
gacaaggaaggctacctgcccgaggccatggtcaactatctggcccgcctgggctggagc
catggcgacgacgaactgttcacgcgcgcccaactggtggaatggttcgacacgcggcac
ctgtccaagtcggcatcgcagtgggatcccaagaagctcaactgggtgaatgcgcactat
cttcggcagatgagcgatgccgacctggccgcgcacgtcgcgccccgcctggcgcggcgt
ggcggcgaccccgcggccgccgacctggcggcagttgtagggctgctgaaagaccgcgcc
gaaaccctggagcaattggccgaaggcgcgatgctcttctgcgggccgttcgggggcgtg
ccggccgaactggcagcgcagcacctcaccgatgcggcgcgcgaggcattgcgcgacttc
gcgcgggagagcgccacctccgactggagccgggagtccctgtcggccaccatcaagaaa
gtactggccgcgcgcggcatcaaaatgccgcagttggccattccgctgcgcgtggcggtt
accgggcagacgcagacgccggccatcgacgccgtgctggcgctgctgggcaaggaaaag
gtgctgcagcggctggaggcagcgctggcatga

DBGET integrated database retrieval system