KEGG   Bordetella flabilis: BAU07_22895Help
Entry
BAU07_22895       CDS       T04592                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bfz  Bordetella flabilis
Pathway
bfz00860  Porphyrin and chlorophyll metabolism
bfz01100  Metabolic pathways
bfz01110  Biosynthesis of secondary metabolites
bfz01120  Microbial metabolism in diverse environments
Module
bfz_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:bfz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BAU07_22895
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bfz01007]
    BAU07_22895
Enzymes [BR:bfz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BAU07_22895
Amino acid related enzymes [BR:bfz01007]
 Aminotransferase (transaminase)
  Class III
   BAU07_22895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ANN80713
UniProt: A0A193GMA1
Position
5136681..5137964
Genome map
AA seq 427 aa AA seqDB search
MPSNAELFERASRSIPGGVNSPVRAFRSVGGTPRFITRGAGPYIWDAEGTRYVDYVGSWG
PAILGHAHPDVVRAVQQAACNGLSFGAPTEAEITLAETLIDRLPSMEQVRLVSSGTEATM
TAIRLARGATARNKIIKFEGCYHGHADSLLVKAGSGLLTFGNPTSAGVPPEFVEHTLVLD
YNDLAAVETAFGQYGHDIACVIVEPVAGNMNLVKPAAGFLEGLRTLCTRHGALLIFDEVM
TGFRVGPQGVQGLTGIKPDLTTLAKVIGGGMPVGAFGGSNEVMRHVAPLGAVYQAGTLSG
NPVAVAAGLETLRLIAAPGFYESLAAQTRKLADGLQERARAAGVAFSADAIGGMFGIYFS
EQVPTSLAQVSACDVEAFKRFFHAMLGHGVHFAPSAFEAGFVSAAHDDSVIGYTLDAAEQ
VFASMKG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcaacgccgaacttttcgaaagagccagccgcagcattcccggcggcgtcaat
tcccctgtccgggcattccgttcggtgggcggtacgccgcgcttcatcacccgcggggcg
gggccgtacatctgggacgccgaggggacgcgctatgtggactatgtcggctcctgggga
ccggcgatcctggggcacgcgcatccggatgtcgtgcgagcggtgcagcaggccgcctgc
aatggactgtcgttcggggcgccgaccgaagcggaaatcacgctggccgagacgctgatc
gatcgcctgccgtcgatggagcaggtgcggctggtgagctccggcacggaagccaccatg
acggcgatacggctggcgcgcggcgcgaccgcgcgcaacaaaatcatcaagttcgaaggc
tgctaccacggccatgcggacagcctgctggtaaaggcgggctccggcctgttgaccttc
ggcaatccgacttccgccggcgtgccgccggagttcgtcgaacatacgctggtgctggac
tacaacgaccttgccgcggtcgagacggcgttcgggcaatacggccacgatatcgcctgc
gtcatcgtcgagccggtggcgggcaatatgaacctggtcaagccggcggccggcttcctg
gaaggcctgcgcaccttatgcacccggcatggggcgctgctcatcttcgacgaagtgatg
acgggttttcgcgtcggaccgcagggcgtgcaagggctgaccggcatcaagccggacctg
acgacattggcgaaggtgatcggcggcggcatgccggtgggcgccttcggcggcagcaac
gaggtcatgcgtcatgtggccccgttgggagccgtgtatcaggccggcacgctttccggg
aacccggtggccgtggcggccgggctggagacgctgcgcttgattgctgcgcccggattc
tatgaatcgctggcggcgcagacgcgcaagctcgcggatgggctgcaggagcgcgcccgc
gcggccggcgtggcgttctcggccgacgcgatcggaggaatgttcggcatctacttcagc
gagcaggtgccgacctcgttggcgcaggtttcggcatgcgacgtagaggcgttcaagcgc
tttttccacgcgatgctggggcacggggtgcatttcgcgccgtcggcctttgaagccggc
ttcgtatccgcggcgcatgacgattcggtcatcggctatacgctggatgcggcggaacag
gtctttgcatccatgaaaggctga

DBGET integrated database retrieval system