KEGG   Bordetella flabilis: BAU07_23435Help
Entry
BAU07_23435       CDS       T04592                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
bfz  Bordetella flabilis
Pathway
bfz00220  Arginine biosynthesis
bfz00250  Alanine, aspartate and glutamate metabolism
bfz00270  Cysteine and methionine metabolism
bfz00330  Arginine and proline metabolism
bfz00350  Tyrosine metabolism
bfz00360  Phenylalanine metabolism
bfz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bfz00401  Novobiocin biosynthesis
bfz01100  Metabolic pathways
bfz01110  Biosynthesis of secondary metabolites
bfz01130  Biosynthesis of antibiotics
bfz01210  2-Oxocarboxylic acid metabolism
bfz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bfz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAU07_23435
   00270 Cysteine and methionine metabolism
    BAU07_23435
   00220 Arginine biosynthesis
    BAU07_23435
   00330 Arginine and proline metabolism
    BAU07_23435
   00350 Tyrosine metabolism
    BAU07_23435
   00360 Phenylalanine metabolism
    BAU07_23435
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAU07_23435
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    BAU07_23435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bfz01007]
    BAU07_23435
Enzymes [BR:bfz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     BAU07_23435
Amino acid related enzymes [BR:bfz01007]
 Aminotransferase (transaminase)
  Class I
   BAU07_23435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ANN79678
UniProt: A0A193GJB7
Position
complement(5261453..5262679)
Genome map
AA seq 408 aa AA seqDB search
MSTTSHSTSPNLLAKRMAAIKPSPSMAAKFKVDTLRREGRTIIDFTIGEPDVSTPAHIAR
AGVAAIESGSVKYTASSGIPELLAAVQQKYRRENRLSFELDQLVAGTGAKQLIFSALQAT
LDPGDEVIIPTPYWVSYPDMVLLNDGEPIILPTTEARGFKISPDALEAAITPRTKWLLLN
APNNPSGSVYSETELAALLAVLERHPHVLLMVDEIYEHFCYGTPYVSVLNVNPALAPRVL
LVNGVSKAYAMTGWRLGYAAGPVWLVKAMSTLISQSTSCASQISQVAAATALSADQQCVA
DIIALYRERRDLIAGLLDGIPFMSCPRPAGAFYVFPNIQGFIGKRTPGGKTIGNDLDFVH
YLLDAAGVAVLDGTAYGNPGHIRLSFATDVDTIRRGCEEISLACGQLN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacttcccattccacgtcgcccaacctcctggcgaagcgcatggccgccatc
aagccttcaccgagcatggcggcgaagttcaaggtcgacacgttgcggcgtgaagggcgg
acgattatcgacttcaccatcggtgagccggacgtaagtacgccggcgcacatcgcccgg
gccggtgtcgccgcgatcgaaagcggatcggtgaagtacaccgcgtcctccgggatcccc
gagcttctggcggcggttcagcagaaataccggcgtgaaaaccgcctttccttcgaattg
gatcaactcgtggccggtacgggcgccaagcagctgatcttctcggcgctgcaggcaacg
ctcgatccaggcgatgaagtcatcattcctacgccgtactgggtttcttatcccgacatg
gtgctgctcaatgacggcgagccgattattctgcccaccaccgaggcacggggtttcaag
atcagcccggacgcgctcgaggcggcgatcacgccgcgcaccaagtggctgctgctgaac
gctcccaataatccatcggggtccgtatacagcgaaaccgagctggccgcgctgttggcc
gtgctggagcgccatccgcacgtgctcttgatggtggacgaaatctacgagcacttttgc
tacggtacaccgtacgtttccgtgctgaacgtgaatccggccctggcgccgcgcgtactg
ctggtcaatggcgtttcaaaggcctatgcgatgacaggctggcggctcggctatgcggcc
ggtcccgtctggctcgtcaaggcgatgtccacgctgatctcgcaatccacgtcctgcgcc
agccagatctcgcaagtggcggccgccaccgcgctttcggccgaccagcagtgcgtggcc
gacatcatcgccctgtacagggaacgccgtgacctgattgccggcctgctcgacgggatt
cccttcatgtcctgcccccggcccgccggcgccttttacgtgttccccaatatccagggt
tttatcggcaagcgcacgcccgggggcaagaccatcgggaatgacctggatttcgtgcat
tacctgctggacgccgcgggcgtcgccgtgctggacggcaccgcctacggcaatcccggc
cacatccgcctgagtttcgccaccgatgtggacaccatacgtcgcggttgcgaagaaatc
tcgctggcatgcggccaactcaactaa

DBGET integrated database retrieval system