KEGG   Borreliella bavariensis PBi: BG0249Help
Entry
BG0249            CDS       T00194                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
bga  Borreliella bavariensis PBi
Pathway
bga00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:bga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BG0249
Enzymes [BR:bga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     BG0249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: AAU07103
UniProt: Q662B8
Position
251229..251834
Genome map
AA seq 201 aa AA seqDB search
MKTLFFATTNENKINEVKNILDMPNLNLVVPKNFNIKETGTTFKENSLLKAKALFAILNK
NQNVFGEDSGLCIEALNLEPGIYSKRYDTYKLCKKLSTNEKNQLILDLMKNEKNRKAYFI
CNISYISKDRQILNFEGIIKGEIALSLNDDKNYGFGYDSIFLTKNNKKLSDLTLEEKNKI
SHRGIAFSKFKKFLLKSLFNN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactattttttgcaacaacaaatgaaaataaaataaatgaggtaaagaatata
ttagatatgcccaatttaaatttagtggtacctaaaaacttcaacataaaagaaacagga
acaacatttaaagaaaactctttacttaaagcaaaagctctgtttgcaattttaaataaa
aatcaaaatgtttttggagaagattctggattgtgcattgaggcactaaacttggagcct
ggaatttactctaaaagatatgacacttataagctatgtaaaaaattaagcactaatgaa
aaaaatcaacttattttagacttaatgaaaaatgaaaaaaacagaaaagcatattttata
tgcaacataagttatatatcaaaagatagacaaatattaaattttgaaggaattattaaa
ggggaaattgccttaagtttaaatgatgataaaaactatggatttggttatgattcaata
tttttaactaaaaataataaaaagcttagcgatctaacacttgaagaaaaaaataaaata
tctcatcggggaatagcattttcaaaatttaaaaaatttttattaaaatctttattcaac
aactaa

DBGET integrated database retrieval system