KEGG   Borreliella bavariensis PBi: BG0571Help
Entry
BG0571            CDS       T00194                                 

Gene name
gnd
Definition
(GenBank) phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bga  Borreliella bavariensis PBi
Pathway
bga00030  Pentose phosphate pathway
bga00480  Glutathione metabolism
bga01100  Metabolic pathways
bga01110  Biosynthesis of secondary metabolites
bga01120  Microbial metabolism in diverse environments
bga01130  Biosynthesis of antibiotics
bga01200  Carbon metabolism
Module
bga_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BG0571 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BG0571 (gnd)
Enzymes [BR:bga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BG0571 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BG0571 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 ApbA NAD_Gly3P_dh_N F420_oxidored 3HCDH_N IlvN Shikimate_DH 2-Hacid_dh_C NAD_binding_11 PepSY_like
Motif
Other DBs
NCBI-ProteinID: AAU07408
UniProt: Q660W3
Position
575829..577223
Genome map
AA seq 464 aa AA seqDB search
MDVGIYGLGVMGGNLALNIADNGFNVSVYNRDSEKTEIFVKQNSHKKINGFKDVESFVKS
LKPPRKIILMVTSLAVEKVVEQILPLLNKSDIIIDGGNSHYKNTMRIEKELFAKDIYFVG
LGISGGERGARFGPALMYGGSKSAYEILEPILNKIAAKTKNNDVCSTYIGENGSGHYVKM
IHNGVEYADMQLISEVYFFMKKAFNLDNSKISEVFEKWNEGDLSGYLLEITSKILRYKEN
NEYLVDKILDVANQKGTGVWTSIDALESSMPVNLILESVFSRFMSGLKHERIIASDLLKM
DTASFEFELSDWILDLYYALLVSKIVAYAQGFMMLKTASVNYSWDLNLGKISLVWREGCI
IRSSFLDKIKLAYDKNPHLINLLFDDYFLDLLKNNHKSLRRIVSKASEIGIPLPAFYASL
SFLDSYSTNYLPSNLIQAQRDFFGAHSFERLDSKRGEFFHSIWQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaggaatttatggtcttggtgttatgggcggcaatttagctctaaatattgct
gataacggttttaatgtttctgtttacaatagagatagtgaaaaaactgaaatttttgtt
aaacaaaattctcataaaaagataaatggctttaaagatgttgaatcttttgttaaaagc
ttaaaacccccaagaaaaatcattttaatggtgacaagtttagctgtagaaaaggttgtt
gaacaaattttaccccttttgaataaatcggacataattattgatggtgggaattctcat
tataagaatacaatgagaatagaaaaagaattgtttgccaaggacatttattttgtaggg
cttggaatttctggaggagagaggggtgcaagatttggtcctgctctaatgtatggaggc
agtaaatcagcttatgaaattcttgagcctattttaaataaaattgcagctaaaactaaa
aacaacgatgtttgttcgacttatattggagagaatggttctggacactatgttaaaatg
atacataatggggttgaatacgctgatatgcagcttattagcgaggtttatttcttcatg
aaaaaagctttcaatttagataattcaaaaatttctgaagtttttgaaaaatggaatgaa
ggcgatctttcagggtatttgctagaaataacttctaagattcttaggtataaagaaaat
aatgaatatttagttgataagattttagatgttgcaaatcaaaaaggtactggtgtttgg
acatctattgatgctcttgaatctagcatgcctgtaaatttaattcttgaatctgttttt
tcaagatttatgtcggggctaaaacacgaaaggattattgctagtgatttgcttaagatg
gatactgcttcttttgagtttgagcttagcgattggattttagatctttattatgctctt
ttggtttcaaaaatagtagcttatgcccaaggttttatgatgcttaagaccgcatctgta
aattatagttgggatttaaatttgggtaaaatttctttagtttggagagaaggctgtatt
attcgtagcagttttttagacaaaattaaattagcttatgataaaaatccccatcttatt
aatttgctttttgatgattattttttggatttattaaaaaataatcacaaatctttgaga
agaatagtttcaaaggctagtgaaattgggattcctttgccagcattttatgccagtctt
tcatttttagattcttattccactaattatttgccttctaatctaattcaagcacaaaga
gacttttttggtgcccattcttttgaaagattagactcaaaacgaggtgaattttttcat
agtatttggcaataa

DBGET integrated database retrieval system