KEGG   Borreliella bavariensis PBi: BG0749Help
Entry
BG0749            CDS       T00194                                 

Gene name
pfk
Definition
(GenBank) pyrophosphate--fructose 6-phosphate 1-phosphotransferase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bga  Borreliella bavariensis PBi
Pathway
bga00010  Glycolysis / Gluconeogenesis
bga00030  Pentose phosphate pathway
bga00051  Fructose and mannose metabolism
bga00052  Galactose metabolism
bga00680  Methane metabolism
bga01100  Metabolic pathways
bga01110  Biosynthesis of secondary metabolites
bga01120  Microbial metabolism in diverse environments
bga01130  Biosynthesis of antibiotics
bga01200  Carbon metabolism
bga01230  Biosynthesis of amino acids
bga03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BG0749 (pfk)
   00030 Pentose phosphate pathway
    BG0749 (pfk)
   00051 Fructose and mannose metabolism
    BG0749 (pfk)
   00052 Galactose metabolism
    BG0749 (pfk)
  Energy metabolism
   00680 Methane metabolism
    BG0749 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BG0749 (pfk)
Enzymes [BR:bga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BG0749 (pfk)
Protein phosphatases and associated proteins [BR:bga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BG0749 (pfk)
Messenger RNA biogenesis [BR:bga03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BG0749 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AAU07575
UniProt: Q660E6
Position
767273..768616
Genome map
AA seq 447 aa AA seqDB search
MYRIKNENLDFKIDSLGECKQNNPLIDFYAGEGSSHFVNEKNKIKFSVYRNEDEGDKYED
ILLEKAGPREKIYFVPRHVKAAITTCGGLCPGFNDVIRSIVRTLWKIYGVRNIYGVKFGY
QGLLPESNSPFINLNPDVGDDINKFGGTILGSSRGGIKPVEIVDTLERMNINMIFNIGGD
GTQKGSLLIAEEIEKRNLKIAVVGIPKTVDNDFMFVQKSFGFETAVEQAVAAVAGAHFEA
NSAYNGIGLVKVMGRDSGFIAAHTALSSNDVNFCLIPELDFDIEGPNGFLVHLERRLLEK
ESLEEIPHAVILIAEGAGQKYFNQFPRKKDDSGNLLYEDIGLYIKDKITEYFKAKNIQFT
LKYIDPSYIIRSSPANASDSLYCARLGSNAVHAAMSGKTKMLISLWSTKFVHIPIKMAVI
DRNKVNPNGSFWRDVLSSTGQPISMKN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgtatagaattaaaaatgaaaatttagattttaaaatagatagtttaggggaatgcaag
caaaacaatcctttgattgatttttatgctggtgagggctcttcacattttgttaatgaa
aaaaataaaattaaatttagtgtatatagaaatgaggacgagggagataagtatgaagat
attcttttagaaaaagctggacctagagaaaaaatttattttgtgcccaggcacgttaaa
gctgctattactacttgcggtggactttgtcctggctttaacgatgttattcgttctatt
gtgcgaactttatggaaaatttatggggttcgtaatatttatggggtaaaatttggatat
caaggtcttcttcctgagtcaaattcaccttttattaatcttaatccagatgttggtgat
gatattaataaatttggaggcactattcttggctcttcaaggggtggtattaaacccgtt
gaaatagttgacactttggagagaatgaacattaatatgatttttaatattggtggagat
ggtactcaaaaggggtctcttcttattgctgaggagatagaaaaaagaaatttaaaaata
gcggttgtaggcattcctaaaactgtagacaatgattttatgtttgttcaaaaatctttt
ggatttgagaccgctgtagaacaagcggttgcagctgttgctggtgctcattttgaagct
aatagtgcttataatggtattggacttgttaaagttatggggcgggattctgggtttatt
gctgctcatactgcgctttcttctaatgatgttaatttttgtttaattccagagcttgat
tttgatatagaaggtcctaatggatttcttgttcatcttgaaagacgacttttagagaaa
gagagcttagaggaaattcctcatgcagtaatattgatagcagaaggagcagggcaaaag
tattttaatcagtttcctcgcaaaaaagacgattctgggaatttgctttatgaggatatt
gggctttatattaaagataaaattacagaatattttaaagcaaaaaatatacaatttact
cttaaatacattgatcccagctatattattagaagttcgcctgctaatgctagtgattca
ctttattgtgctaggcttggttcaaatgctgtgcatgctgcaatgtctggcaagacaaaa
atgttgattagtttgtggagtacaaagtttgtgcacataccgattaagatggcagtaatt
gacagaaataaggttaatcccaatggttctttttggagagatgttctttcaagcacagga
caaccgattagcatgaagaattaa

DBGET integrated database retrieval system