KEGG   Borrelia garinii subsp. bavariensis: BG0836
Entry
BG0836            CDS       T00194                                 
Symbol
mviN
Name
(GenBank) virulence factor mviN protein
  KO
K03980  putative peptidoglycan lipid II flippase
Organism
bga  Borrelia garinii subsp. bavariensis
Brite
KEGG Orthology (KO) [BR:bga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bga01011]
    BG0836 (mviN)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bga02000]
    BG0836 (mviN)
Peptidoglycan biosynthesis and degradation proteins [BR:bga01011]
 Precursor biosynthesis
  Flippase
   BG0836 (mviN)
Transporters [BR:bga02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BG0836 (mviN)
SSDB
Motif
Pfam: MurJ Polysacc_synt_C MatE RIFIN
Other DBs
NCBI-ProteinID: AAU07658
UniProt: A0A7I6GX43
Position
857879..859399
AA seq 506 aa
MNKYVISTVLVMISTFFSRIMGFIKVKIFSYYFGANLDADIFNYVFNIPNNLRKILSEGA
MTSAFLPEFTCEKNKSHEKAVSFFRTVITFNVIAIGLIVLVMIIFAKPIMYFLSYYRGEN
LIFASSVFSYLVLYILLISLSSIFISVLNSYKIFFIPSFSPIMFSFGIILSIFLFYGRFG
IYSAVIGVIFGGFLQFLIPFVNCLMIGFVFKPTFYFREKVFLNFLSRWVRMIFGFSISII
TQQISFALASTLDIGSVSILSNAIVYYQLPIGIFYISIATVIFPKMAEYAVLGNNIKLNT
LLVDGIKILLLIFIPVSFLMFIWSDYILNLLLMGGKFSIYDTQKTAGVLKCFLLGLLFYS
MFSFFQKYYFSIRDAKTPFYLSVLFSILDILLSVFGIKHYGLNALALAQSISFMICVIVF
YFIILKSGVKIDLIEILFVLLKSIITLFPLYLIYFFFEKFQWNVGFSFKNLYFLITAGIV
SILTLFICYSVLGINKLFRFIRRDVL
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgaataaatatgttatttctacagttttggtcatgatttctacctttttttcaagaata
atggggtttataaaggtaaagattttctcttattattttggagcaaatcttgatgctgat
atttttaactatgttttcaatattcctaacaatttgcgcaaaattctttcagagggcgca
atgacttcagcttttttgcctgaatttacatgtgaaaaaaataaatcgcacgaaaaagct
gtttctttttttagaaccgttataacttttaatgttattgctattggtttaattgtatta
gtcatgattatttttgcaaagcctattatgtattttctgtcttattataggggagaaaac
ttaatttttgcaagttctgtatttagttatttggtattatatattttactaataagttta
tcatcaatcttcatatctgttctaaattcatataaaattttttttattccttcattttca
cctattatgttttcttttggaataatattgagcatatttttattttatggccgttttgga
atatatagtgctgttattggcgtaatttttggggggtttttacaatttctaattccgttt
gtaaattgtcttatgattggttttgtctttaagccaacattttattttagagaaaaggta
tttttaaattttttaagtagatgggttcgtatgatttttggattttctatttcaattatt
actcagcagatttcatttgcattagcatctacccttgacataggaagtgtttctattctt
agtaatgctatagtttattatcagcttcctataggaattttttatatttctattgcaacg
gtaatttttcctaaaatggcagagtatgctgttttgggaaataatataaaattaaatacc
cttttagtggatggaattaaaattttattgttaatttttattccggtgtcttttttgatg
tttatttggtctgattatattttaaatttacttcttatgggaggtaagttttctatttat
gatactcaaaaaacagcgggtgttttgaaatgttttcttttaggtttacttttttattct
atgtttagtttttttcaaaaatattatttttctattcgtgatgcaaaaacaccattttat
ttgagtgttttattttctattcttgatattttactttctgtttttggtattaagcattat
ggtttgaatgctttggcattggctcaatctatttcttttatgatttgtgtaattgttttt
tattttataatattgaaaagtggagttaaaattgatttaattgaaattttatttgttctt
ctaaagtcaattattacacttttccctttgtatttaatttatttcttttttgaaaagttt
cagtggaatgtgggttttagttttaaaaatctttattttttaattacggcaggaattgtt
agtattttaactttatttatttgttattctgttttaggaataaataaactttttaggttt
attaggagggatgttttatga

DBGET integrated database retrieval system