KEGG   Borreliella garinii BgVir: KK9_0209Help
Entry
KK9_0209          CDS       T02048                                 

Gene name
gtaB
Definition
(GenBank) GtaB
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bgb  Borreliella garinii BgVir
Pathway
bgb00052  Galactose metabolism
bgb00500  Starch and sucrose metabolism
bgb00520  Amino sugar and nucleotide sugar metabolism
bgb01100  Metabolic pathways
bgb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KK9_0209 (gtaB)
   00052 Galactose metabolism
    KK9_0209 (gtaB)
   00500 Starch and sucrose metabolism
    KK9_0209 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    KK9_0209 (gtaB)
Enzymes [BR:bgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KK9_0209 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEW68546
Position
linear:208310..209146
Genome map
AA seq 278 aa AA seqDB search
MKGIILAAGYGTRFLPITKTIPKEMLPILNKPAIDYIIQEFIDSGIKDILLISSRRKKVL
EDYFDREIELENIFLKENKKNELEKIKNKKINISFIRQKEMLGTGNALLYAKPWISREPV
IVAYPDDLHIGNPPLSLQLIKLYEKTGKNIISIIENPENINRYGVIDLYEDKIHVKNIVE
KPKIGSEPSNKASIGRFLYNYEFFEHLEEGFKLHQKGEYYHIYALKKLMYQKKVLYKNIK
GKRIDIGTLEGYLEAIINFAKKDKKLMEIIKKGINEND
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcattattctagcagctgggtatggaacaagatttttaccaataacaaaaaca
attccaaaagaaatgttgccaattttaaacaaaccagccatagattatattatccaagaa
tttatcgattcaggaataaaagacattttattaataagctcaagacgaaaaaaagttctt
gaagattattttgatagagaaattgaacttgaaaatatttttttaaaagaaaataaaaaa
aatgaattagaaaaaatcaaaaacaaaaaaattaacataagcttcataagacaaaaagaa
atgctgggcacaggaaatgctctgctttatgcaaaaccctggataagtagagagcctgta
attgtagcttaccctgacgatcttcacattggaaatccaccattaagcttacaattaatc
aaactttatgaaaaaactggaaagaacataatatctattattgaaaatccagaaaatata
aacagatacggagtaatagatctatatgaagataaaatccatgtaaaaaacattgttgaa
aaaccaaaaattggaagtgagcctagcaataaagcatctattggaagatttttgtataac
tatgagttttttgaacatttagaagaaggatttaaactacatcaaaagggtgaatactat
cacatttatgctttaaaaaaactcatgtatcaaaaaaaagtattatataaaaatattaag
gggaaaagaattgatataggaactcttgagggctatttagaagcaataataaattttgca
aaaaaagataaaaaattaatggaaattataaaaaaaggaataaatgaaaacgattaa

DBGET integrated database retrieval system