KEGG   Borreliella garinii BgVir: KK9_0490Help
Entry
KK9_0490          CDS       T02048                                 

Gene name
lspA
Definition
(GenBank) LspA
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
bgb  Borreliella garinii BgVir
Pathway
bgb03060  Protein export
Brite
KEGG Orthology (KO) [BR:bgb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    KK9_0490 (lspA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bgb01002]
    KK9_0490 (lspA)
Enzymes [BR:bgb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     KK9_0490 (lspA)
Peptidases [BR:bgb01002]
 Aspartic Peptidases
  Family A8: signal peptidase II family
   KK9_0490 (lspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_A8
Motif
Other DBs
NCBI-ProteinID: AEW68807
Position
linear:491564..492070
Genome map
AA seq 168 aa AA seqDB search
MSAKSKQYFNIFVFVISLIFFDQLSKYLVVKYVKLGSIYFSFFDNFFRIIHVRNTGILFS
MGSNIHYSLKKIFFLAMPIFILIFVFSLALKEKNCITRISLLLIFSGGVGNIIDRLFRPS
GVVDFLDFKFYGIFGLDRWPTFNFADSYVVIGMILFLIYDFFYKKKSA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctaaaagtaaacaatattttaatatttttgtatttgttattagtttaattttt
tttgatcaactttctaagtatttggttgtgaagtatgtcaaattgggttcaatatatttt
tctttttttgataatttttttaggataatacatgtaagaaacacgggcattttattttcc
atgggttctaacatccattatagtttgaaaaaaattttttttcttgcaatgcctattttc
atcttaatatttgttttttctcttgctttgaaagagaaaaattgtattaccagaatttca
cttttattaattttttcaggaggggtggggaatattattgatagattatttagaccttct
ggagttgtagattttttagattttaaattttatggaatttttggacttgacagatggcct
acttttaattttgcagatagctatgttgttataggaatgattttatttttgatttatgat
tttttttataaaaagaaaagcgcttaa

DBGET integrated database retrieval system