KEGG   Borreliella garinii CIP 103362: BLA33_01915Help
Entry
BLA33_01915       CDS       T04731                                 

Definition
(GenBank) signal peptidase II
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
bgc  Borreliella garinii CIP 103362
Pathway
bgc03060  Protein export
Brite
KEGG Orthology (KO) [BR:bgc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BLA33_01915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bgc01002]
    BLA33_01915
Enzymes [BR:bgc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     BLA33_01915
Peptidases and inhibitors [BR:bgc01002]
 Aspartic peptidases
  Family A8: signal peptidase II family
   BLA33_01915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_A8
Motif
Other DBs
NCBI-ProteinID: APQ15108
Position
complement(413711..414217)
Genome map
AA seq 168 aa AA seqDB search
MGAKSKQYFNIFVFVISLIFFDQLSKYLVVKYVKLGSIYFSFFDNFFRIIHVRNTGILFS
MGSDIHYSLKKIFFLAMPIFILIFVFSLALKEKNCISRISLLLIFSGGVGNIIDRLFRPS
GVVDFLDFKFYGIFGLDRWPTFNFADSYVVIGMILFLVYDFFYKKKSA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctaaaagtaaacaatattttaatatttttgtatttgttattagtttaattttt
tttgatcaactttctaagtatttggttgtgaagtatgtcaaattgggttcaatatatttt
tccttttttgataatttttttaggataatacatgtaagaaatacgggcattttattttca
atgggttctgatatccattatagtttgaaaaaaattttttttcttgcaatgcctattttt
atcttaatatttgttttttctcttgctttgaaagagaaaaattgtattagcagaatttca
cttttattaattttttcaggaggggtggggaatattattgatagattatttagaccctcc
ggagttgtagattttttagattttaaattttatggaatttttggacttgacagatggcct
acttttaattttgcagatagctatgttgttataggaatgattttatttttggtttatgat
tttttttataaaaagaaaagcgcttaa

DBGET integrated database retrieval system