KEGG   Burkholderia gladioli BSR3: bgla_1g02780Help
Entry
bgla_1g02780      CDS       T01464                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bgd03012]
    bgla_1g02780
   03029 Mitochondrial biogenesis [BR:bgd03029]
    bgla_1g02780
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bgd04147]
    bgla_1g02780
Translation factors [BR:bgd03012]
 Eukaryotic Type
  Elongation factors
   bgla_1g02780
 Prokaryotic Type
   bgla_1g02780
Mitochondrial biogenesis [BR:bgd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    bgla_1g02780
Exosome [BR:bgd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   bgla_1g02780
  Exosomal proteins of breast cancer cells
   bgla_1g02780
  Exosomal proteins of colorectal cancer cells
   bgla_1g02780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase Lsm_C
Motif
Other DBs
NCBI-ProteinID: AEA58974
UniProt: F2LHP7
Position
1:323842..325032
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSSKFGGEAKKYDEIDAAPEEKARG
ITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLALE
GDKGELGETAIMSLADALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIKDTQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
IKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKILD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaaatttgagcggaccaagccgcacgtcaacgtcggtacgatcggtcac
gttgaccacggcaagacgacgctgacggcagccatcgcaacggttctgtcgtcgaagttc
ggcggcgaagcgaagaagtacgacgaaatcgatgcggcgccggaagaaaaggcacgtggt
atcacgatcaacaccgcgcacatcgagtacgaaacggcgaaccgccactacgcacacgtc
gattgcccgggccacgccgactatgtgaagaacatgatcacgggtgccgcgcagatggac
ggcgcgatcctggtgtgctcggccgccgacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgaactcctgtcgaag
tacgacttcccgggcgacgacacgccgatcatcaagggttcggcgaagctggcgctggaa
ggcgacaagggcgagctgggcgagacggcgatcatgagcctggccgacgcgctggacacg
tacatcccgacgccggagcgcgcggtcgacggtacgttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgcggcacggtggtgacgggtcgtgtcgagcgtggcatcgtgaag
gtcggcgaggaaattgaaatcgtcggcatcaaggacacgcagaagacgacctgcacgggc
gtggaaatgttccgcaagctgctggaccaaggtcaggctggcgacaacgtgggtatcctg
ctgcgcggtacgaagcgtgaagacgtggagcgtggccaggttctggccaagccgggttcg
atcaagccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggcggc
cgccacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtcatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgctccgatcgcgatggaagaaggtctgcgcttcgcgatccgc
gaaggtggccgtaccgtcggcgccggcgtcgtcgccaagatcctcgactaa

DBGET integrated database retrieval system