KEGG   Burkholderia gladioli BSR3: bgla_1g03760Help
Entry
bgla_1g03760      CDS       T01464                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00340  Histidine metabolism
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    bgla_1g03760
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     bgla_1g03760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Rieske
Motif
Other DBs
NCBI-ProteinID: AEA59070
UniProt: F2LHZ3
Position
1:421585..422913
Genome map
AA seq 442 aa AA seqDB search
MSIKIRKLDSSREGFAADLRAVLAFEASEDDAIERSVAAILADVKARGDAAVLDYTNRFD
RLQAASVAALELRQDALEAALEGLEPKRRAALEAAAARVRGYHEKQKLECGSHSWQYTES
DGTVLGQKVTPLDRVGLYVPGGKAAYPSSVLMNAIPARVAGVGEIVMVVPTPDGVSNELV
LAAAYLGGVDRVFTIGGAQAVAALAYGTETVPAVDKICGPGNAYVASAKRRVFGTVGIDM
IAGPSEILVICDGTTDPHWVAMDLFSQAEHDELAQSILLCPDAAFIERVEKAIDELLPSM
PREAVIRASLEGRGALVKVRDMAEACRIANDIAPEHLEISALEPQQWGKQIRHAGAIFLG
RYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFIKRSSVIEVSAEGAQTLGEIASELA
YGEGLQAHARSAEYRMRHHGHH
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcaagattcgcaaactcgattccagccgcgaagggttcgcggccgacctgcgt
gcggtgctcgcgttcgaggcgagcgaggacgacgcgatcgagcgctcggtcgcggccatc
ctggccgacgtgaaggcgcgcggcgacgcggccgtgctcgactacacgaaccgcttcgac
cgcctgcaggccgccagcgtggccgcgctggagctgcgccaggacgcgctggaagccgcg
ctggaagggctcgagcccaagcgccgcgcggcgctggaggcggccgccgcgcgcgtgcgc
ggctaccatgagaagcagaagctcgagtgcggcagccatagctggcagtacaccgaatcg
gatggcacggtgctgggccagaaggtcacgccgctcgaccgcgtcggcctctacgtgccg
ggcggcaaggccgcctatccctcctcggtgctgatgaacgcgattccggcgcgggtcgcc
ggggtcggcgagatcgtgatggtggtgcccacccccgacggcgtgagcaacgagctggtg
ctggccgcggcctacctgggcggcgtcgatcgcgtgttcaccatcggcggcgcgcaggcg
gtggccgcgctcgcctacggcaccgaaaccgtgccggcggtcgacaagatctgcggcccg
ggcaatgcctatgtggcctcggccaagcgccgcgtgttcggcacggtcggcatcgacatg
atcgccgggccctccgagatcctggtgatctgcgacggcaccaccgatccgcactgggtg
gcgatggacctgttctcgcaggccgagcacgacgagctcgcgcagtcgatcctgctgtgc
cccgacgcggccttcatcgagcgcgtcgagaaggcgatcgacgagctgctgccgagcatg
ccgcgcgaggccgtgatccgcgcctcgctggaagggcgcggcgcgctggtcaaggtgcgc
gacatggccgaggcctgccggatcgccaacgacatcgcgcccgagcacctggagatctcc
gcgctcgagccgcagcaatggggcaagcagatccgccacgccggcgcgatcttcctcggc
cgctacaccagcgagagcctgggcgactactgcgcgggcccgaaccacgtgctgccgacc
tcgcgcaccgcgcgcttctcctcgccgctgggcgtctacgacttcatcaagcgctccagc
gtgatcgaggtcagcgccgagggcgcgcagacgctcggcgagatcgcctccgagctggcc
tacggcgaaggcctgcaggcgcatgcacgcagcgccgagtaccggatgcgccaccacggc
caccactga

DBGET integrated database retrieval system