KEGG   Burkholderia gladioli BSR3: bgla_1g04140Help
Entry
bgla_1g04140      CDS       T01464                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgd02044]
    bgla_1g04140
Secretion system [BR:bgd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bgla_1g04140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: AEA59107
UniProt: F2LI30
Position
1:453243..455081
Genome map
AA seq 612 aa AA seqDB search
MEELLPYYERELSFLRRYSHEFARRYPKIAARLAMTGEHCDDPHVERMIESFALLGARIN
KKLDDDYPEFTEALVDVLYPHYLRSFPSCSIAQFTPSANVSQQTAPHRVARGTELKSRAI
RGVQCQFRTAYDVTIAPIRISEARYSSIAAAPAATVLPGNATGVISITFESMAPQFDLAG
LKLPTLRAHLHGEQSFVAALADCLFINTLATYVEPERNGRWTALRSSPVTQAGFEEHDAL
IDYPSRSHPAYRLLTEYFAFPDKFDFVDFDLAAMTRRAGPCHRLTLHIVLADVRSDSHVA
RLLDMLSATHLRLFCTPVVNLFKQNGEPIRIDHQSVSYPVIAEARRAFAYEVYSIDSVHL
VRQTAHEESVVEFRPFYSLHHGEAGHVGHYWFARRNDWVAQHSPGYETEISIVDIDFEPS
APQTDTLSLRLTCTNRDLPAGLATGLAGGDLFADGGADFGDITMLRRPSPSVRFARGRAA
HWRLISHLALNHVSLANDGLAPLKELLTLYDLRRSAVSTRHIDGLVAIEQRGAVQWLPGK
PFATFVRGIEIRLTIDEEHFVGTSLASFVRMLDAFFGLYVHLNSFVQLIVVSKRTGEEIM
RCKPRSGESILA
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggaagagttgctgccgtactacgagcgcgaattatcgtttttacggcggtactcgcac
gaattcgcccgacgctacccgaagatcgccgcgcgcctggcgatgaccggcgagcattgc
gacgacccgcacgtcgagcgcatgatcgagtccttcgcgctgctgggcgcgcgcatcaac
aagaagctcgacgacgactacccggaattcaccgaggcgctggtcgacgtgctgtatccg
cactacctgcgctcgttcccgtcctgttcgatcgcgcagttcacaccgagcgccaacgtc
tcgcagcagaccgcgccgcatcgggtggcgcgcggcaccgagctgaagagccgcgcgatc
cgcggcgtgcaatgccagttccgcaccgcctacgacgtgacgatcgcgccgatccgcatc
tccgaggcgcgctattcctcgatcgccgccgcgccggccgccaccgtgctgcccggcaac
gccaccggcgtgatctcgatcaccttcgaatcgatggcgccgcagttcgacctggccggg
ctcaagctgccgacgctgcgcgcccacctgcacggcgagcagtccttcgtcgccgcgctg
gccgactgcctgttcatcaacacgctcgccacctatgtcgagcccgagcgcaacggccgc
tggaccgcgctgcgcagctcgcccgtcacccaggccggcttcgaggagcatgacgcgctg
atcgactacccgtcgcgctcgcacccggcctaccgcctgctgaccgaatacttcgcgttc
cccgacaagttcgacttcgtcgatttcgacctggccgcgatgacgcgccgcgccggcccc
tgccaccgcctgaccctgcacatcgtgctggccgacgtgcgcagcgactcgcacgtggcg
cggctgctcgacatgctgagcgcgacccacctgcgcctgttctgcacgccggtggtcaac
ctgttcaagcagaacggcgagccgatccgcatcgaccaccagagcgtctcctacccggtg
atcgccgaggcgcgccgcgccttcgcctacgaggtctattcgatcgattcggtgcacctg
gtgcgccagaccgcgcacgaggagtcggtggtcgagttccggcccttctattcgctgcac
catggcgaggccgggcatgtcggccattactggttcgcgcgccgcaacgactgggtggcc
cagcacagccccggctacgagaccgagatctcgatcgtcgacatcgacttcgagccttcc
gcgccgcagaccgacacgctgagcctgcgcctgacctgcaccaaccgcgacctgccggcg
gggctggccaccggcctggccggcggcgacctgttcgccgacggcggcgccgatttcggc
gacatcacgatgctgcgccggcccagccccagcgtgcgtttcgcgcgcgggcgcgccgcc
cactggcggttgatctcgcacctggcgctgaaccacgtgtcgctggccaacgacggcctg
gcgccgctcaaggaactgctcacgctctacgacctgcgccgttcggcggtctcgacccgg
catatcgacgggctggtggcgatcgagcagcgcggcgccgtgcaatggctacccggcaag
cccttcgcgaccttcgtgcgcggtatcgagatccgcctgacgatcgacgaggagcatttc
gtcggcaccagcctggcgtccttcgtgcggatgctcgacgccttcttcggcctctacgtc
cacctcaacagctttgtccaattgatcgtcgtgtccaagcgcaccggcgaggagatcatg
cgatgcaaaccgcgcagcggcgaatcgatcctggcgtag

DBGET integrated database retrieval system