KEGG   Burkholderia gladioli BSR3: bgla_1g04850Help
Entry
bgla_1g04850      CDS       T01464                                 

Definition
(GenBank) hypothetical protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00071  Fatty acid degradation
bgd00280  Valine, leucine and isoleucine degradation
bgd00281  Geraniol degradation
bgd00310  Lysine degradation
bgd00360  Phenylalanine metabolism
bgd00362  Benzoate degradation
bgd00380  Tryptophan metabolism
bgd00410  beta-Alanine metabolism
bgd00627  Aminobenzoate degradation
bgd00640  Propanoate metabolism
bgd00650  Butanoate metabolism
bgd00903  Limonene and pinene degradation
bgd00930  Caprolactam degradation
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01120  Microbial metabolism in diverse environments
bgd01130  Biosynthesis of antibiotics
bgd01212  Fatty acid metabolism
Module
bgd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    bgla_1g04850
   00650 Butanoate metabolism
    bgla_1g04850
  Lipid metabolism
   00071 Fatty acid degradation
    bgla_1g04850
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    bgla_1g04850
   00310 Lysine degradation
    bgla_1g04850
   00360 Phenylalanine metabolism
    bgla_1g04850
   00380 Tryptophan metabolism
    bgla_1g04850
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    bgla_1g04850
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    bgla_1g04850
   00281 Geraniol degradation
    bgla_1g04850
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bgla_1g04850
   00627 Aminobenzoate degradation
    bgla_1g04850
   00930 Caprolactam degradation
    bgla_1g04850
Enzymes [BR:bgd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     bgla_1g04850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Carboxyl_trans Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AEA59178
UniProt: F2L7H3
Position
1:535835..536629
Genome map
AA seq 264 aa AA seqDB search
MIEEKSMDYQNILVETRGRVGLITLHRPKALNALNDALMDELGAALKAFDADEGIGAIVL
TGSEKAFAAGADIGMMANYSYMDAYKGDYITRNWETIRQIRKPIIAAVAGFALGGGCELA
MMCDIIIAADTAKFGQPEIRLGVMPGAGGTQRLPRAVSKAKAMDMCLTARFMEAAEAERA
GLVSRVVQAASLLDDALAAAATISEFSLPAVMMVKESVNRAYETTLAEGVTFERRLFHST
FATEDQKEGMAAFVEKRKPVFKHR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaggagaaatcgatggattaccagaacatcctggtggagacccgggggcgtgtc
ggcctgatcacgctgcatcgtccgaaggcgctcaacgcgctcaacgatgcgctgatggac
gagctcggcgcggcactgaaggccttcgacgccgacgaagggatcggggcgatcgtgctg
accggcagcgagaaggcgttcgcggccggcgccgacatcgggatgatggcgaactactcc
tatatggatgcctacaagggcgactacatcacgcgcaactgggagacgatccggcagatc
cgcaagccgatcatcgcggcggtggcggggttcgcgctgggcggtggctgtgagctggcg
atgatgtgcgacatcatcatcgccgccgacacggcgaagttcggccagcccgagattcgg
ctcggcgtgatgccgggcgcgggcggcacgcagcgcctgccgcgcgcggtgtcgaaggcc
aaggcgatggacatgtgcctgaccgcgcgcttcatggaggcggcggaggccgagcgggcc
gggctggtgtcgcgcgtggtgcaggcggcgtcgctgctcgacgatgccctggccgcggcc
gcgacgatctccgagttctccctgccggccgtgatgatggtgaaggagtcggtgaatcgt
gcgtacgaaacgacgctggcggaaggcgtgacgttcgagcggcgcctgttccattcgacg
ttcgccaccgaggaccagaaggagggaatggcggcgttcgtggagaagcgcaagccggtg
ttcaagcatcgctga

DBGET integrated database retrieval system