KEGG   Burkholderia gladioli BSR3: bgla_1g08720Help
Entry
bgla_1g08720      CDS       T01464                                 

Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00030  Pentose phosphate pathway
bgd00480  Glutathione metabolism
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01120  Microbial metabolism in diverse environments
bgd01130  Biosynthesis of antibiotics
bgd01200  Carbon metabolism
Module
bgd_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bgd_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
bgd_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    bgla_1g08720
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    bgla_1g08720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bgd04147]
    bgla_1g08720
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     bgla_1g08720
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     bgla_1g08720
Exosome [BR:bgd04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   bgla_1g08720
  Exosomal proteins of colorectal cancer cells
   bgla_1g08720
  Exosomal proteins of bladder cancer cells
   bgla_1g08720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N Fimbrillin_C
Motif
Other DBs
NCBI-ProteinID: AEA59559
UniProt: F2L9G5
Position
1:complement(973658..975130)
Genome map
AA seq 490 aa AA seqDB search
MQNDSSSFTFVLFGGTGDLSMRKILPALFEAHRANMLAESGRIVAVARHDADRAGYHDWV
EEHVKPHARKASGSAFDEAAWKRFLERIDYLNVDLGRPADYQVLREAIGELPGTRVFYLA
TGPSLFEPICKALAGVGLSEGARIVLEKPLGYDLASSNEINDAVGEIFAEDQIYRIDHYL
GKEPVQNLLALRFGNALFEPLWRREWVESIQITIAEELGVEARGDFYDNTGALRDMVQNH
LLQLLSIIAMEPPHSMDSDSVRDEKLRVLRALKPIDPRDISKVAVRGQYHAGTIKGNPVP
GYATEPGVKPDSNTETYVALKVEIENWRWAGVPFFLRTGKRLADRVAEIVVNFRAVPHSA
LGPNALRAGTNRLVIRLQPNETIRLYCLAKQPGEGMNLASVHLDLAFDQFFKEGQMEAYQ
RLLLDVINGRLALFVRRDEQEAAWRWVEPIQNEWQKSLKPPKPYAAGTWGPAAASAMLAQ
HGTCWLEEEN
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacgattccagcagcttcaccttcgtactgttcggcggcaccggcgacctgtcg
atgcgcaagatcctgccggcgctgttcgaggcacatcgcgccaacatgctcgccgagtcc
ggccgcatcgtcgcggtcgcgcgccacgatgcggatcgcgccggctatcacgactgggtc
gaggagcacgtcaagccgcatgcgaggaaggcgtccggcagcgccttcgacgaagccgcc
tggaagcggttcctggaacgcatcgactatctcaacgtcgatctcggccgccccgcggac
taccaggtcctgcgcgaggcgatcggcgagctgcccggcacgcgcgtgttctacctggcc
accggcccttccctgttcgaaccgatctgcaaggcgctggccggcgtcggcctgagcgag
ggcgcgcgcatcgtgctggagaagccgctcggctacgacctggcctcctccaacgagatc
aacgacgcggtcggcgagatcttcgcggaagaccagatctaccggatcgaccactacctc
ggcaaggagccggtacagaacctgctcgcgctgcgcttcggcaatgcgctgttcgagccg
ctgtggcgccgcgaatgggtggagagcatccagatcacgatcgccgaggaactgggcgtg
gaggcgcgcggcgacttctacgacaacaccggcgcgctgcgcgacatggtgcagaaccac
ctgctgcaactgctctcgatcatcgcgatggagccgccgcattcgatggattcggattcg
gtgcgcgacgagaagctgcgcgtgctgcgcgcgctcaagccgatcgatccgcgcgacatc
agcaaggtggcggtgcgcggccagtatcacgccggcaccatcaagggcaacccggtgccc
ggctacgcgaccgaacccggcgtgaagcccgacagcaacaccgaaacctacgtggcgctg
aaggtcgagatcgagaactggcgctgggccggcgtgcccttcttcctgcgcaccggcaag
cggctggccgatcgcgtcgccgagatcgtggtcaatttccgcgcggtgccgcattccgcg
ctcggccccaatgcgttgcgcgccggcaccaaccggctggtgatccgcctgcagcccaac
gagacgatccgcctgtattgcctggccaagcagcccggcgagggcatgaacctggccagc
gtgcatctcgacctggccttcgaccagttcttcaaggaaggccagatggaggcctaccag
cgcctgctgctcgacgtgatcaacgggcgcctggcgctgttcgtgcggcgcgacgagcag
gaagcggcctggcgctgggtcgagccgatccagaacgaatggcagaagtcgctcaagccg
cccaagccctacgcggccggcacctggggccccgcggcggccagcgcgatgctcgcgcag
cacggcacctgctggctcgaggaagaaaactga

DBGET integrated database retrieval system