KEGG   Burkholderia gladioli BSR3: bgla_1g09130Help
Entry
bgla_1g09130      CDS       T01464                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00230  Purine metabolism
bgd01100  Metabolic pathways
Module
bgd_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    bgla_1g09130
Enzymes [BR:bgd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     bgla_1g09130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 MMR_HSR1 RsgA_GTPase ABC_tran AAA_18 AAA_16 AAA_22 AAA_29 AAA_23 Septin cobW Dynamin_N
Motif
Other DBs
NCBI-ProteinID: AEA59598
UniProt: F2LAU8
Position
1:1018230..1018904
Genome map
AA seq 224 aa AA seqDB search
MIESNRDAHALHAGAYPGNLFMVVAPSGAGKSTLVNALLAKDSEICLSISYTTRKPRPGE
QDGEHYHFTSVEDFRARHARHEFLESAEVHGNYYGTSRVWIEEQMQSGRDVLLEIDWQGA
QQVKKQFRNAVGIFILPPSLAALEERLKKRGQDEPNVITRRLLAAGSEIAHASEAEYVVI
NEHFDTALSELQRIVAATRLRVASQYARHTELFIELGIHLPHAD
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaatcgaaccgagacgcgcatgcgctgcatgccggcgcgtatcccggcaacctg
ttcatggtggtggcgccctcgggcgcgggcaagtcgaccctggtgaacgcgctgctcgcc
aaggacagcgagatctgcctgtcgatctcgtacaccacgcgcaagccgcgtccgggcgag
caggacggcgagcactaccacttcaccagcgtcgaggatttccgcgcgcgccacgcgcgt
cacgaattcctggaaagcgccgaggtgcacggcaactactacgggacctcgcgcgtgtgg
atcgaggagcagatgcaaagcggtcgcgacgtgctgctcgagatcgactggcagggcgcg
cagcaggtcaagaagcagttccgcaacgcggtcggcatcttcatcctgccgccctcgctg
gcggcgctcgaggagcgactgaagaagcgcggccaggacgagccgaacgtgatcacgcgg
cgcctgctggccgccggcagcgagatcgcgcacgcctcggaagccgaatacgtggtgatc
aacgagcacttcgacacggcgctgtccgagctgcaacgcatcgtggcggccacgcgcctg
cgcgtggcctcgcaatacgcgcggcacaccgagcttttcatcgagctcggcatccatctc
ccgcacgccgactga

DBGET integrated database retrieval system