KEGG   Burkholderia gladioli BSR3: bgla_1g13580Help
Entry
bgla_1g13580      CDS       T01464                                 

Definition
(GenBank) DJ-1/PfpI family protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    bgla_1g13580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bgd01002]
    bgla_1g13580
Enzymes [BR:bgd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     bgla_1g13580
Peptidases [BR:bgd01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   bgla_1g13580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AEA60032
UniProt: F2L8A1
Position
1:complement(1507117..1507806)
Genome map
AA seq 229 aa AA seqDB search
MSHRIALLMFPGVQALDLVGPYDVFAALPDTTVHLVSRDGAPVQAAHGLTLSPDTRFEDC
PPVDVLCVPGGRGIGELLLDDATLSFLRRAAGTARYLSSVCTGSLVLGAAGLLQGRRATT
HWAFLPLLEAFGATPVRERVVRDGSLVTGGGITAGIDFALTIARELHGDAVAQATQLSIE
YAPAPPFDAGSPETAPAEVVAAVRERYAPIYATREALVKRAAERLGTGR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatcgaatcgcattgctgatgtttcccggcgtccaggcgctcgacctggtcggc
ccctacgacgtgttcgccgccctgcccgacacgacggtccacctggtctcccgtgacggc
gcgccggtgcaggccgcgcatggcctgacgctgagccccgatacgcgcttcgaggattgc
ccgccggtggacgtgctgtgcgtgcccggtgggcgcggcatcggcgagctgctgctcgac
gacgcgaccctgtccttcctgcgccgggccgccggcaccgcgcgctacctgagctcggtc
tgcaccggctcgctggtgctcggcgcggccggcctgctgcaaggccggcgcgccaccacg
cactgggccttcctgccattgctggaagccttcggggccacgccggtgcgcgagcgcgtg
gttcgcgacggcagcctcgtgaccggcggcggcatcaccgctggcatcgatttcgcgctg
accatcgcgcgcgagctgcatggcgacgccgtcgcgcaggccacccagttgtcgatcgaa
tacgcgcccgcgccgccgttcgacgccggcagccccgagacggcgccggccgaggtggtc
gcggccgtgcgcgagcgctacgcgccgatctacgcgacccgcgaggccctggtgaagcgt
gccgccgaacggctcggcaccggacgttga

DBGET integrated database retrieval system