KEGG   Burkholderia gladioli BSR3: bgla_1g16690Help
Entry
bgla_1g16690      CDS       T01464                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00053  Ascorbate and aldarate metabolism
bgd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    bgla_1g16690
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     bgla_1g16690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 NmrA Ldh_1_N adh_short
Motif
Other DBs
NCBI-ProteinID: AEA60318
UniProt: F2LED8
Position
1:1875599..1876408
Genome map
AA seq 269 aa AA seqDB search
MRKVLITGAAGQIGRVLREGLRGAYPLLRLADIAAQQPAREGEQVITVDINDPDALLRAM
DGIDCVVHLAGIPDEDSWERIRRMNIEGCYNVFEAARLAGVKRVIFASSNHAVGFHRRDR
MIDDQVQPRPDSRYGVSKVFGEALGRLYADKHGLSVACLRIGSFRPDDRPSAPRHLYTWI
SHRDTVQLVRRAIDHPDYHFVVVYGVSDNARNRWDNANARWLGYRPEDDAERHAAGILAG
SAAEDELEALFHGGFGCRVEYTGDPDRVD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggtattgatcacgggcgcggcggggcagatcggccgcgtgctgcgcgagggg
ctgcgcggggcctatccgctgctgcggctggccgatatcgccgcgcagcagccggcgcgc
gagggcgagcaggtcatcacggtcgacatcaacgatcccgatgcgctgctgcgcgcgatg
gacggcatcgactgcgtggtgcacctggcgggcattcccgacgaggatagctgggagcgg
atccgccgcatgaacatcgagggctgctacaacgtgttcgaggcggcgcggctggccggc
gtgaagcgcgtgatcttcgcgagctcgaaccacgcggtgggtttccatcggcgcgatcgc
atgatcgacgaccaggtccagccgcggcccgacagccgctacggcgtgtccaaggtgttc
ggcgaggcgctcgggcgcctctatgccgacaagcacgggctctcggtggcctgcctgcgg
atcggctcgttccgccccgacgaccggcccagcgcgccgcgccatctctacacctggatc
agccatcgcgacacggtgcaactggtgcgccgcgcgatcgaccatccggattatcacttc
gtggtcgtgtatggcgtgtcggacaacgcgcgcaaccgctgggacaacgccaatgcgcgc
tggctcggctaccggcccgaggacgatgccgagcgccacgcggccgggattctcgccggc
tcggccgccgaggacgaactcgaggcgctgttccatggcggcttcggctgccgcgtcgag
tacacgggcgatccagaccgggtcgattga

DBGET integrated database retrieval system