KEGG   Burkholderia gladioli BSR3: bgla_1g22670Help
Entry
bgla_1g22670      CDS       T01464                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00071  Fatty acid degradation
bgd00072  Synthesis and degradation of ketone bodies
bgd00280  Valine, leucine and isoleucine degradation
bgd00310  Lysine degradation
bgd00362  Benzoate degradation
bgd00380  Tryptophan metabolism
bgd00620  Pyruvate metabolism
bgd00630  Glyoxylate and dicarboxylate metabolism
bgd00640  Propanoate metabolism
bgd00650  Butanoate metabolism
bgd00900  Terpenoid backbone biosynthesis
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01120  Microbial metabolism in diverse environments
bgd01130  Biosynthesis of antibiotics
bgd01200  Carbon metabolism
bgd01212  Fatty acid metabolism
bgd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    bgla_1g22670
   00630 Glyoxylate and dicarboxylate metabolism
    bgla_1g22670
   00640 Propanoate metabolism
    bgla_1g22670
   00650 Butanoate metabolism
    bgla_1g22670
  09103 Lipid metabolism
   00071 Fatty acid degradation
    bgla_1g22670
   00072 Synthesis and degradation of ketone bodies
    bgla_1g22670
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    bgla_1g22670
   00310 Lysine degradation
    bgla_1g22670
   00380 Tryptophan metabolism
    bgla_1g22670
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    bgla_1g22670
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bgla_1g22670
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    bgla_1g22670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bgd04147]
    bgla_1g22670
Enzymes [BR:bgd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     bgla_1g22670
Exosome [BR:bgd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bgla_1g22670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEA60894
UniProt: F2LBJ4
Position
1:complement(2604471..2605652)
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKIAAPELGASVIRAVLERSGVAPDQISEVIMGQVLTAA
SGQNPARQAVIKAGLPTAVPGMTINKVCGSGLKAVMLAANAIIAGDAEIVIAGGQENMSA
APHVLPGSRDGFRMGDAKLVDSMIVDGLWDVYNNYHMGITAENVAREYGITREAQDAFAA
LSQNKAEAAQKSGRFDDEIVPIEIPQRKGEPIRFASDEFVRHGVTAESLAGLKPAFSKEG
SVTAANASGLNDGAAAVLVMSAEKAKALGLTPLARIKAYANAGVDPKVMGMGPVPASRRC
LERAGWSVGDLDLMEINEAFAAQALAVHQQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMQKRDAKRGLASLCIGGGMGVALAVERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtagtgatcgtatcggccgcgcgcaccgcggtcggcaaattcggtggttcg
ctggccaagattgccgcgccggaactgggcgcgagcgtgattcgcgccgtgctggaacgc
agcggcgtggcgcccgaccagatcagcgaagtgatcatgggtcaggtgctgacggccgca
tcgggtcagaacccggcgcgccaggccgtgatcaaggcgggcctgcccaccgccgtgccc
ggcatgaccatcaacaaggtctgcggctccggcctgaaggccgtgatgctggccgccaac
gcgatcatcgcgggcgacgccgagatcgtcatcgcgggcggccaggagaacatgagcgcg
gcgccgcacgtgctgccgggctcgcgcgacggcttccggatgggcgacgccaagctggtc
gacagcatgatcgtggacggcctctgggacgtctacaacaactaccacatgggcatcacc
gccgagaacgtggccagggaatacggcatcacgcgcgaggcccaggacgccttcgcggcg
ctctcgcagaacaaggccgaggccgcccagaagtcgggccgcttcgacgacgagatcgtg
ccgatcgagatcccgcagcgcaagggcgagccgatccgcttcgccagcgacgagttcgtg
cgccacggcgtgacggccgagtcgctggcgggcctcaagcccgccttctcgaaggaaggt
tcggtgacggcggccaatgcctcgggcctcaacgacggcgccgccgcggtgctggtgatg
tcggccgagaaggccaaggcgctcggcctcacgccgctcgcgcgcatcaaggcctacgcc
aatgccggcgtcgacccgaaggtgatgggcatgggcccggtgccggcctcgcgccgctgc
ctggagcgcgccggctggtcggtcggcgatctcgacctgatggagatcaacgaggccttc
gcggcgcaggcgctggccgtgcaccagcagatgggctgggatacctcgaaggtgaacgtg
aacggcggtgcgatcgcgatcggtcatccgatcggtgcatccggttgccggatcctggtc
acgctgctgcacgagatgcagaagcgcgatgcgaagcgcggcctcgcatcgctgtgtatc
ggcggcgggatgggcgtggcgctggcggtcgagcgcccgtga

DBGET integrated database retrieval system