KEGG   Burkholderia gladioli BSR3: bgla_1g31000Help
Entry
bgla_1g31000      CDS       T01464                                 

Definition
(GenBank) Putative two-component system, response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    bgla_1g31000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bgd02022]
    bgla_1g31000
Two-component system [BR:bgd02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   bgla_1g31000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C B12-binding FleQ
Motif
Other DBs
NCBI-ProteinID: AEA61708
UniProt: F2LFS4
Position
1:complement(3519648..3520373)
Genome map
AA seq 241 aa AA seqDB search
MTTQILIVDDDQELRDLLRDYLVRQGMEVSVLHDAATLEKRLERERPDLIVLDLMMPGVD
GLTALRQLRAAGDDIPVIMLTARADDVDRIVGLELGADDYLGKPFNPRELLARAQAVLRR
RRATPSAAAPEQREPYAFGRFVLDFQARTLSVDGKPATLSSSEFALLKIFVNNALRTLTR
ERLLELLHGPEYDGTDRGIDVQVWRLRRILESDPSTPRFIQTVRGRGYVFVPNGEAHAQT
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgactacccagatcctcatcgtcgacgacgaccaagaactgcgcgacctgctgcgcgac
tatctcgtgcgccaaggcatggaagtatcggtgctgcacgacgcggccaccctggagaag
cgcctggagcgcgagcgccccgacctgatcgtgctcgacctgatgatgccgggcgtcgat
ggcctgaccgcgctgcgccagttgcgcgcggccggcgacgacattccggtgatcatgctg
accgcgcgcgccgacgacgtcgaccgcatcgtcggcctcgagctcggtgccgacgactac
ctcggcaagcccttcaacccgcgcgaactgctggcccgtgcccaggcggtgctgcgccgg
cgccgcgccacgccctcggcggccgcgcccgagcagcgcgaaccctatgcgttcggccgc
ttcgtgctcgacttccaggcgcgcacgctgtcggtcgacggcaagccggccacgctgtcg
agcagcgaattcgcgctgctgaagatcttcgtcaacaacgcgctgcgcacgctgacgcgc
gaacgcctgctcgaactgctgcacggcccggaatacgacggcaccgaccgcggcatcgac
gtgcaggtgtggcgtctgcggcggatcctggaaagcgatccgtccacgccgcgcttcatc
cagacggtgcgcggacgcggctacgtgttcgtgcccaacggcgaggcccatgcgcagacc
cattga

DBGET integrated database retrieval system