KEGG   Burkholderia gladioli BSR3: bgla_1g31050Help
Entry
bgla_1g31050      CDS       T01464                                 

Definition
(GenBank) Amino acid ABC transporter, ATP-binding protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    bgla_1g31050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgd02000]
    bgla_1g31050
Enzymes [BR:bgd01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     bgla_1g31050
Transporters [BR:bgd02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    bgla_1g31050
   Histidine transporter
    bgla_1g31050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_15 AAA_16 AAA_13 APS_kinase AAA_33 ATPase_2 RsgA_GTPase PRK AAA_22 G-alpha AAA_23 DUF87
Motif
Other DBs
NCBI-ProteinID: AEA61713
UniProt: F2LFS9
Position
1:3524038..3524805
Genome map
AA seq 255 aa AA seqDB search
MHKLFVDDLHKQYGSNEVLKGVSLKAHAGDVISVIGSSGSGKSTMLRCINFLEQPNAGRI
FVDGEEVRTAKDKGGALKAADTRQLQRVRTKLAMVFQHFNLWSHMNVLENVIEAPVNVLK
LSRREAEERAREYLEKVGLAPRLEKQYPSHLSGGQQQRVAIARALAMQPDVMLFDEPTSA
LDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRVEEEGAPAEVFGN
TRSERLKQFLSGSLK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagcttttcgtcgacgatctccacaagcagtacggcagcaacgaagtcctcaag
ggcgtgtcgctgaaggcgcatgccggcgacgtgatcagcgtgatcggctcgtccggctcg
ggcaagagcaccatgctgcgctgtatcaacttcctcgagcaaccgaacgccgggcgcatc
ttcgtcgacggcgaagaggtgcgcaccgcgaaggacaagggcggcgcgctgaaggcggcc
gacaccaggcagctgcagcgtgtgcgcaccaagctggcgatggtgttccagcacttcaac
ctgtggtcgcacatgaacgtgctcgagaacgtgatcgaggcgcccgtgaacgtgctgaag
ctgtcgcgccgcgaggccgaggaacgcgcccgcgaatatctcgagaaggtgggcctcgcg
ccgcgcctcgagaagcagtatccctcgcatctttccggcggccagcagcagcgcgtggcg
atcgcccgcgcgctggccatgcagcccgacgtgatgctgttcgacgagcccacctccgcg
ctcgatccggagctggtgggtgaagtgctgaaggtgatgcagaagctggccgaggaaggc
cgaaccatgatcgtggtgacgcacgagatgggcttcgcgcgcaacgtctcgaaccacgtg
atgttcctgcaccagggccgcgtcgaggaagaaggcgcgccggccgaggtgttcggcaat
acccgcagcgaacgcctcaagcagttcctgtcgggcagcctgaagtaa

DBGET integrated database retrieval system