KEGG   Burkholderia gladioli BSR3: bgla_1g32840Help
Entry
bgla_1g32840      CDS       T01464                                 

Definition
(GenBank) Tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00380  Tryptophan metabolism
bgd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    bgla_1g32840
Enzymes [BR:bgd01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     bgla_1g32840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: AEA61890
UniProt: F2L8W2
Position
1:3723474..3724388
Genome map
AA seq 304 aa AA seqDB search
MIVNPDHSKTDGADAPPRCPFSGTPAPAAAGAEGWHDAQLDFSKSMSYGDYLSLGSILKA
QHPLSPDHNEMLFIIQHQTSELWMKLALYELRAALDSIRRDALPPAFKMLARVSRILEQL
VQAWNVLATMTPSEYSAMRPYLGASSGFQSYQYRQLEFLLGNKNEQMLKPHAHRPDILAE
VEATLDAPSLYDEVVRLLARRGFPIAAERLARDWRAPTAHDASVEAAWLAVYRDPAAHWE
LYEMAEELVDLEDAFRQWRFRHVTTVERIIGFKQGTGGTNGAPYLRKMLDVVLFPELWHV
RTTL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgtgaatcctgaccattccaagaccgatggcgccgatgcgccgccgcgctgcccg
ttctcgggcacgccggccccggccgccgccggcgccgagggctggcacgacgcccagctc
gatttctcgaagtcgatgagctatggcgactacctgtcgctcggctcgatcctgaaggcc
cagcatccgctctcgcccgaccacaacgagatgctgttcatcatccagcaccagaccagc
gaactgtggatgaagctggcgctctacgagctgcgcgcggcgctcgattcgatccgccgc
gatgcgctgccgcctgccttcaagatgctggcgcgcgtctcgcgcatcctcgagcaactg
gtgcaggcctggaacgtgctggccaccatgacgccatcggagtattcggcgatgcgcccc
tacctgggcgcttcctcgggcttccagtcctatcagtaccggcagctcgaattcctgctc
ggcaacaagaacgagcagatgctcaagccgcacgcgcatcgcccggacatcctcgccgag
gtggaagccacgctcgacgcgccctcgctctacgacgaggtggtgcgcctgctggcgcgg
cgcggtttcccgatcgcggccgagcggctcgcgcgcgactggcgcgcgccgaccgcgcac
gacgcctcggtcgaggcggcctggctcgccgtctatcgcgatcccgccgcgcactgggag
ctctacgagatggccgaggaactggtcgacctcgaggatgcgttccggcaatggcgcttc
cggcatgtcaccaccgtcgagcgcatcatcggcttcaagcagggcacgggcggcaccaac
ggcgcgccctatctgcgcaagatgctagacgtggtgctgttccccgagctgtggcacgtg
cgcaccacgctgtag

DBGET integrated database retrieval system