KEGG   Burkholderia gladioli BSR3: bgla_1g33400Help
Entry
bgla_1g33400      CDS       T01464                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00020  Citrate cycle (TCA cycle)
bgd00640  Propanoate metabolism
bgd00660  C5-Branched dibasic acid metabolism
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd01120  Microbial metabolism in diverse environments
bgd01130  Biosynthesis of antibiotics
bgd01200  Carbon metabolism
Module
bgd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bgla_1g33400
   00640 Propanoate metabolism
    bgla_1g33400
   00660 C5-Branched dibasic acid metabolism
    bgla_1g33400
Enzymes [BR:bgd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     bgla_1g33400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp UPF0227
Motif
Other DBs
NCBI-ProteinID: AEA61946
UniProt: F2LAE3
Position
1:complement(3787749..3788915)
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVEDAVKVAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSIEQVREYASQILGMQLVTHQTGPEGQKVNRLMVEEGADIKQELYVSLVVDRVSQK
IVLMGSSEGGMDIEEVAEKHPELIHQVIVEPSTGLLDAQADDLAAKIGVPAASIPQARAI
LQGLYKAFWETDASLAEINPLNVSSDGKVTALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPDLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLGVPLVVRMKGTNEDLGKKM
LAESGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtcccg
cgcggcaagccggcgttctcggttgaagatgccgtcaaggtggcagaagagctgggcggc
ccggtgtgggtcgtgaaggctcagattcacgcgggtggccgtggcaagggcggcggcgtg
aaggtggcgaagtcgatcgagcaggttcgcgagtacgcgagccagatcctcggcatgcag
ctcgtcacccaccagaccggcccggaaggccagaaggtcaaccgcctgatggtcgaggaa
ggcgccgacatcaagcaggaactgtatgtcagcctcgtcgtcgatcgcgtgtcgcaaaag
atcgtcctgatgggttcgagcgaaggcggcatggacatcgaggaagtggccgaaaagcat
ccggagctgatccaccaggtcatcgtcgagccgtcgaccggcctgctcgatgcacaggcc
gacgacctcgccgcgaagatcggcgtgccggctgcctcgattccgcaagcgcgcgcgatc
ctgcaaggcctgtacaaggcgttctgggaaaccgacgcgtcgctggccgaaatcaatccg
ctgaacgtctccagcgacggcaaggtcaccgccctcgacgcgaagttcaacttcgattcg
aacgcgctgttccgtcacccggaaatcgtcgcctaccgcgatctggacgaagaagatccg
gctgaaatcgaggcttcgaagttcgatctcgcctacatctcgctggacggcaacatcggc
tgcctggtgaatggcgccggcctggcgatggccaccatggacaccatcaagctgttcggc
ggcgaaccggcgaacttcctggacgtcggcggtggcgcgacgaccgagaaggtcacggaa
gcgttcaagctgatgctgaagaacccggacctgaaggcaatcctggtcaacatcttcggc
ggcatcatgcgctgcgacgtgatcgccgaaggcgtgatcgccggctcgaaggccgtgaac
ctcggcgtgccgctggtggtgcgcatgaagggcaccaacgaagacctgggcaagaagatg
ctggccgagtcgggcctgccgatcatctcggcggacagcatggaagaagccgcgcagaag
gtcgtcgcggcagccgccggcaagtaa

DBGET integrated database retrieval system