KEGG   Burkholderia gladioli BSR3: bgla_2g00980Help
Entry
bgla_2g00980      CDS       T01464                                 

Definition
(GenBank) mandelate racemase/muconate lactonizing protein
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00051  Fructose and mannose metabolism
bgd01100  Metabolic pathways
bgd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    bgla_2g00980
Enzymes [BR:bgd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     bgla_2g00980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-ProteinID: AEA62579
UniProt: F2LJB8
Position
2:113908..115167
Genome map
AA seq 419 aa AA seqDB search
MRVLDVRFPTSRQLDGSDAMNPDPDYSAAYVVLETDREGLEGHGLTFTIGRGNEICCATI
EAMRHLVVGLDLDWIREDMGRFWRHVTSDSQLRWIGPDKGAIHLATGAVVNAAWDLWAKA
EGKPLWRLVADLTPEQFVRAIDFRYLTDCLTQDEALELLRKQAPGKAERIATLEREGYAC
YTTSAGWLGYSDDKLRRLCHEAIDAGFNHVKLKVGANLEDDIRRVSIAREVIGPDRKLMI
DANQVWEVDEAIDWVRELAFAKPWFIEEPTSPDDVEGHRKIREAIGPVQVATGEMCQNRV
LFKQFIARGAIDVVQIDACRLGGVNEILAVMLMAAKYGLPVCPHAGGVGLCEYVQHLAMI
DYVCIAGTREGRVIEYVNHLHEHFVEPCVVRDAAYMPPSAPGFSIEMKPESLEQYRFRG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcctcgacgtgcgctttccgacttcacgccagctcgacggctccgacgcgatg
aatccggatcccgattattcggccgcctatgtcgtgctcgaaaccgatcgggaaggcctg
gaaggacacgggctgaccttcacgatcggccgcggcaacgagatctgctgcgcgacgatc
gaggcgatgcgccatctggtggtgggtctcgacctggactggattcgcgaggacatgggc
cgcttctggcgccacgtgacctcggacagccaactgcgctggatcggcccggacaagggc
gcgatccacctggccaccggcgcggtggtcaatgccgcctgggacctgtgggccaaggcc
gagggcaagcccttgtggcgcctggtggccgacctgacgcccgagcaattcgtgcgcgcc
atcgacttccgctacctgaccgattgcctgacgcaggacgaggcgctggaactgctgcgc
aagcaggcgcccggcaaggccgagcggatcgccacgctcgaacgcgagggttacgcctgc
tacaccacctcggccggctggctcggctacagcgacgacaagctgcgccggctctgccat
gaagcgatcgacgccggtttcaatcacgtgaagctgaaagtcggcgcgaacctggaggac
gacatccgccgcgtgagcattgcgcgtgaggtgatcggccccgatcgcaagctgatgatc
gacgccaaccaggtctgggaagtggacgaggcgatcgactgggtgcgcgagctggccttc
gccaagccgtggttcatcgaggagcccaccagccccgacgacgtggaaggccatcgcaag
atccgcgaggcgatcggcccggtgcaggtggccaccggcgagatgtgccagaaccgcgtg
ctgttcaagcagttcatcgcgcgcggcgcgatcgacgtggtgcagatcgacgcctgccgg
ctcggcggcgtcaacgagatcctggcggtaatgctgatggccgcgaaatacggcttgccg
gtatgcccgcacgcgggcggcgtgggcctgtgcgaatacgtgcagcacctggcgatgatc
gactacgtctgcatcgccggcacgcgcgagggccgcgtgatcgagtatgtcaaccacctt
cacgagcatttcgtcgagccctgcgtggtgcgcgacgcggcctacatgccgccgagcgcg
cccggcttctcgatcgagatgaaacccgaatcgctggagcagtaccggttccgaggctga

DBGET integrated database retrieval system