KEGG   Burkholderia gladioli BSR3: bgla_2g04010Help
Entry
bgla_2g04010      CDS       T01464                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgd02044]
    bgla_2g04010
Secretion system [BR:bgd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bgla_2g04010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: AEA62877
UniProt: F2LJL0
Position
2:505705..507042
Genome map
AA seq 445 aa AA seqDB search
MTQSNKVVWSEGLFLRPQHMQQQERYLERYVELRAGALRPHAWGFQELELESDLLAIGKL
GIKRARGVFPDGTPFAMPGDDPLPPPLDIESNWRDQVVHLTLPLRSATQPDSAWPGADGD
QLYRYRVREAEVRDASGSMEGLTALEVAGMSARLVPDAQPTEGLMRIPVARVVECRADRR
VVLDEGFMPSALNTEAAARLVTFLSELLGLLHQRGEALAGRVAETDRGGAAEIADFLMLQ
VINRYQPLVAHLAAAPLLHPEALYQLLIELAGELATFTAPGKRAQAFPPYRHEMLRESFE
PVIVALRIALSAVLEQSAVPIPLQQRKYGVWVGVVPDLTLLDTATFVLAAKADMKAEDMR
RQLPTQSKIGPVEKIRDLVNLQLPGIGVSPMAVAPRQLPYTSGFLYFECDRNSSMWRMLK
TSGGIAMHFGSGFAGLDLQFWAVRT
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgacccagagcaataaagtggtatggagcgagggcctgttcctgcggccccagcacatg
cagcagcaggagcgctacttggagcgctacgtggagctgcgcgccggcgcgctgcgtccg
cacgcgtggggcttccaggagctcgagctggagagcgacctgctcgcgatcggcaagctc
ggcatcaagcgcgcgcgcggcgtgtttcccgacggcacgccgttcgcgatgcccggcgac
gatccgctgccgccgccgctcgacatcgaatcgaactggcgcgaccaggtggtgcacctg
accttgccgctgcgctcggccacccagcccgacagcgcctggcccggcgccgacggcgac
cagttgtatcgctaccgggtgcgcgaggccgaggtgcgcgacgcctcgggcagcatggaa
gggctgaccgcgctggaggtggccggcatgagcgcgcgcctggtgcccgacgcgcagccc
accgagggcctgatgcggatcccggtggcgcgcgtggtggagtgccgtgccgatcgccgc
gtggtgctcgacgagggcttcatgcccagcgccctgaacaccgaggcggccgcgcggctg
gtgaccttcctctccgagctgctgggcctgctgcaccagcgcggcgaggcgctggccggg
cgcgtggccgagaccgatcgcggcggcgcggccgagatcgccgacttcctgatgctgcag
gtgatcaaccgctaccagccgctggtggcgcacctggccgccgcgccgctgctgcatccc
gaggcgctctaccagttgctgatcgagctggccggcgagctggccaccttcacggcgccg
ggcaagcgcgcgcaggccttcccgccgtatcgccacgagatgctgcgcgagagcttcgag
ccggtgatcgtggcgctgcgcatcgcgctgagcgcggtgctcgagcagagcgccgtgccg
atcccgctgcagcagcgcaagtacggcgtgtgggtgggcgtggtgcccgacctcacgctg
ctcgacaccgccaccttcgtgctggccgccaaggccgacatgaaggccgaggacatgcgc
cggcaattgccgacgcagtcgaagatcggcccggtcgagaagatccgcgacctggtcaac
ctgcaactgcccggcatcggcgtctcgccgatggccgtcgccccgcgccagcttccctac
acctccggcttcctctacttcgaatgcgaccgcaattcgtcgatgtggcggatgctgaag
acctcgggcggcatcgccatgcacttcggcagcggcttcgcgggcctcgacctgcaattc
tgggcggtgcgcacatga

DBGET integrated database retrieval system