KEGG   Burkholderia gladioli BSR3: bgla_2g04030
Entry
bgla_2g04030      CDS       T01464                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    bgla_2g04030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgd02044]
    bgla_2g04030
Secretion system [BR:bgd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bgla_2g04030
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C AAA_33 AAA_16 Cyt_bd_oxida_II AAA_22 AAA_29 AAA_24 MMR_HSR1 AAA_18 DUF4131
Other DBs
NCBI-ProteinID: AEA62879
UniProt: F2LJL2
Position
2:508453..512049
AA seq 1198 aa
MNLLKTWVRSRWFASAVGLALIAVLIWLGGPYLGLGDRQPLASPAARLALILALVLAWLV
VLLVLQWRAQRKTARLSGELAGQEAKLAAEEPGSAERAALQQRFREAIDTLRRTRRNGRN
LYALPWYVVIGPPGSGKSTLLQNSGLDFPLSERFGNNALRGIGGTRDCDWWFTDEAVFLD
TAGRYTTQDSDAAADASAWQAFLTLLRRYRRRRPLNGVIVTMSVSDLLSFDETARQQHMR
AVRRRLDELTQYLKVPVPVYLVFTKSDLVAGFGEFFDDLGPELRAQVWGMTFPLEASLDG
TACSRFAGEYDLLLERLNTRLIERLHAERDRGRRAAVLSFPQQLGAFREIARQFVEGTFG
RNEYGTPPLLRGAYLSSGTQEGAPIDRMLGAVARTFGVDAARVQPGTSQRRTFFVERLLK
EVLFRESGLAGTNPRLERQKLLVQIAAYAGITLFTVLMVAGFATSYARNRAYVAEVQDSL
KDLPGADTLAGQPDLRSYFARALARLEVISDTQDSAGRYRDHVPLLMRFGLFQGRALYAQ
AHGAYLRELDGTLLPGVGLRFREGLTDSANDPQTLYGYLKGYLMLGEPQHLVPDELAALA
RQEWQRLFPDDPAIRKALDKHFTARVEDPQRPRALSLDSGLVDQARATLKTADLATLIYG
SVKLDADRSGVSPVRLDESLGLLGNVFRRKSGTPLAQPLPVLFTRPYFAYEVNGGLDRSV
DGFVKDYWVFDTGRVDPLARSRYAQQVLTLYEQDYIRNWDGLLGDLQLQPVVSIQDASAL
AAKLSGPSSPLKALLNLVRDNTSDLLRSGPAGANGASGVAGVSGTEVGDQAKTIGENIAA
RRALNTRLAGELRTAGAPLPYGVTLASRNHGGGQDAGSQPGAAIEAHFAQIDQLSLGSPG
ATPLDHTIGVLDQLGKTLLTMNDLSDPSAQNNPALLSARQEAQQLPPQVAGLISGLTGKS
ADLVASGGSAALADQFRAAAGNDCASFVDGRYPFASGGATDIPLQNFTELFGGGGRFDAF
FKSALAARVDTGGSAWRWKPNMPPAPSGVLAGAQLADEIRQLYFGGGAQVHVGFTLLAPQ
FDTAIARVVVEVDGQKYDFTANAASVASSSMSWPGPQPGHVVISAFDGSNHPVGTPYRFD
GDWSLFHALDAGRLQKEGELRFTASYDFAGHPVKLTIQPASLRNPFLNDAVRRFRCPR
NT seq 3597 nt   +upstreamnt  +downstreamnt
atgaacctgctgaaaacctgggtgcggtcccggtggttcgcctcggcggtcggcctcgcg
ctgatcgccgtgctgatctggctcggcggcccctatctcggcctcggcgatcgccagccg
ctggccagccccgccgcgcgcctggcgctgatcctcgcgctggtgctggcctggctggtg
gtgctgctggtgctgcaatggcgcgcccagcgcaagaccgcgcgcctgtccggcgagctg
gccgggcaggaggccaagctggccgccgaggagccgggcagcgccgagcgcgccgccttg
cagcagcgctttcgcgaggccatcgacacgctgcgccgcacgcgccgcaacggccgcaat
ctctacgcgctgccgtggtacgtggtgatcgggccgccgggctcgggcaagagcaccctg
ctgcagaattccgggctcgatttcccgctgtccgagcgcttcggcaacaatgcgctgcgc
ggcatcggcggcacgcgcgactgcgactggtggttcaccgacgaggccgtgttcctcgac
accgccgggcgctacaccacgcaggattccgacgcggccgccgacgcctcggcctggcag
gccttcctgaccctgctgcgccgctatcgccgccgccggccgctgaacggcgtgatcgtg
acgatgagcgtgtcggacctgctgagcttcgacgaaaccgcgcgccagcagcacatgcgc
gcggtgcgccggcgcctggacgaactcacgcaatacctgaaggtgccggtgccggtctac
ctggtgttcaccaagagcgacctggtggcgggcttcggcgagttcttcgacgacctcggc
cccgagctgcgcgcccaggtctggggcatgaccttcccgctcgaggccagcctcgacggc
accgcctgcagccgcttcgcgggcgaatacgacctgctgctggagcgcctcaacacgcgc
ctgatcgagcgcctgcacgccgagcgcgaccgcggccggcgcgccgccgtgctgagcttc
ccgcagcagctcggcgcgttccgcgagatcgcgcggcagttcgtggaaggcaccttcggg
cgcaacgaatacggcacgccgccgctgttgcgcggcgcctacctcagctcgggcacgcag
gaaggcgcgccgatcgatcgcatgctcggcgcggtggcgcgcaccttcggcgtcgatgcc
gcgcgcgtgcagcccggcaccagccagcgccgcaccttcttcgtcgagcgcctgctcaag
gaggtgctgttccgcgaatcgggcctggccggcaccaacccgcgcctggagcgccagaag
ctgctggtccagatcgccgcctatgccggcatcaccctgttcacggtgctgatggtggcc
ggcttcgccaccagctacgcgcgcaaccgcgcctacgtggccgaggtgcaggacagcctg
aaggacctgcccggcgccgacacgctggccgggcagcccgacctgcgcagctatttcgcg
cgcgcgctggcgcggctggaggtgatctcggacacgcaggattcggcgggccgctatcgc
gatcatgtgccgctgctgatgcgcttcgggctgttccagggccgagcgctctatgcgcag
gcgcacggtgcctacctgcgcgagctcgacggcaccctgcttcccggcgtcggcctgcgt
ttccgcgaggggctgaccgacagcgccaacgatccgcagacgctgtacggctacctgaag
ggctacctgatgctcggcgagccgcagcacctggtgcccgacgagctggccgcgctggcg
cgccaggaatggcagcgcctgttccccgacgatccggcgatccgcaaggcgctcgacaag
cacttcacggcgcgcgtcgaggatccgcagagaccgcgcgcgctgtcgctcgacagcggc
ctggtggaccaggcccgcgccacgctgaagacggccgacctcgccacgctgatctacggc
agcgtcaagctcgacgccgatcgctccggcgtctcgccggtgcggctcgacgaatcgctg
ggcctgctcggcaacgtgttccgtcgcaagagcggcacgccgctcgcgcagccgctaccg
gtgctgttcacgcggccgtatttcgcctacgaggtgaacggcgggctcgatcgctcggtg
gacggcttcgtcaaggactactgggtgttcgacacgggccgcgtcgatccgctggcgcgc
tcgcgttacgcgcagcaggtgctcacgctctacgagcaggactacatccgcaactgggac
ggcctgctcggcgatctgcagctgcagccggtggtcagcatccaggacgccagcgcgctg
gccgcgaagctgtcggggccgagctcgccgctcaaggcgctgctgaacctggtgcgcgac
aacaccagcgacctgctgcgcagcggcccggccggcgccaacggcgcaagcggcgtggcg
ggcgtatcgggcaccgaggtgggcgaccaggccaagaccatcggcgagaacatcgccgcg
cgccgcgcgctgaacaccaggctggccggcgagctgcgcacggccggcgcgccgctgccc
tatggcgtgacgctggcctcgcgcaaccacggcggcggccaggacgccggcagccagccg
ggcgcggcgatcgaggcgcatttcgcgcagatcgaccagctgagcctgggttcgcccggc
gccacgccgctcgatcacacgatcggcgtgctcgaccagctcggcaagaccctgctgacc
atgaacgacctcagcgacccgagcgcgcagaacaacccggccctgctgtcggcgcgccag
gaagcgcagcaactgccgccgcaggtggcggggctgatctcgggcctgaccggcaagagc
gccgacctggtggccagcggcggcagcgccgcgctggccgaccagttccgcgcggcggcc
ggcaacgactgcgcgagcttcgtcgacggccgctacccgttcgcctcgggcggcgccacc
gatatcccgctgcagaacttcaccgagctgttcggcggcggcgggcgcttcgacgccttc
ttcaagtcggcgctggccgcgcgcgtcgacaccggcggcagcgcctggcgctggaagccg
aacatgccgccggccccgagcggcgtgctggccggcgcgcaactggccgacgagatccgc
cagctctacttcggcggcggcgcccaggtgcatgtgggcttcaccctgctcgcgccgcag
ttcgacaccgcgatcgcgcgcgtggtggtggaggtggacggccagaagtacgacttcacg
gccaatgccgccagcgtggcctccagctcaatgagctggcccggcccgcagcccggccat
gtggtgatcagcgccttcgacggctcgaaccacccggtcggcacgccctacaggttcgac
ggcgactggtcgctgttccatgcgctcgacgcggggcgcctgcagaaggagggcgagctg
cgcttcacggccagctacgatttcgccggccatcccgtgaagctgacgatccagcccgcc
agcctgcgcaaccccttcctcaatgacgcggtgcgtcgcttcaggtgcccgcgatga

DBGET integrated database retrieval system