KEGG   Burkholderia gladioli BSR3: bgla_2g04080
Entry
bgla_2g04080      CDS       T01464                                 

Definition
(GenBank) type VI secretion-associated protein, ImpA family
  KO
K11902  type VI secretion system protein ImpA
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgd02044]
    bgla_2g04080
Secretion system [BR:bgd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bgla_2g04080
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: AEA62884
UniProt: F2LJL7
Position
2:complement(517880..518953)
AA seq 357 aa
MTHSDSTDPNPLLAAIDDAAPTGPDLEYDPAFTDLERIAMPTPERAMGDSLKAAQEPDWD
KVAQAAEALFARTKDLRVAVHLTAARTRRQGLAGWASGLALVRELLERYWDDVHPRLDAE
DDNDPTARVNAVMPLGDPQGTLAYFRVVPFVQSPRLGRFSLRDLRVATGAITAAPSPDGS
PPPTLVDLEACCLDCPEEQLPESAALLAAAQDHANALIALLRERLGTASPDFGLLAADIA
ELRKFVDAQLLRRFPERAAELAAAAQADGADGEIPADMAAAAAAVAPPPGKISGHDDVIR
RLDEICEYYERIEPSSPLPILLKRARRLVGKSFVEVLRDIAPGGLSELQTLSGPEAD
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgacccattccgactcgaccgacccgaacccgctgctcgccgcgatcgacgacgcggcg
cccaccggccccgatctcgaatacgaccccgccttcaccgatctcgagcggatcgccatg
cccacccccgagcgcgccatgggcgacagcctgaaggccgcccaggagcccgactgggac
aaggtcgcgcaagcggccgaggcgctgttcgcgcgcaccaaggacctgcgcgtggccgtg
cacctgaccgccgcgcgcacgcgccgccagggcctggcgggctgggcctcgggcctggcc
ctggtgcgcgagctgctggagcgctactgggacgacgtgcatccccggctcgacgccgag
gacgacaacgacccgaccgcgcgcgtcaacgcggtgatgccgctgggcgacccgcagggc
acgctggcctatttccgcgtggtgcccttcgtgcagtcgccgcggctcggccgcttctcg
ctgcgcgacctgcgcgtggcgaccggcgcgatcaccgccgcgccctcgcccgacggctcg
ccgccgccgaccctggtcgacctggaagcctgctgcctcgactgccccgaggagcagttg
ccggaatcggccgcgctgctggccgccgcgcaggatcacgccaacgcgctgattgccctg
ctgcgcgagcggctcggcaccgcgagccccgatttcgggctgctggccgcggatatcgcc
gagctgaggaaattcgtcgatgcccagttgttgcggcgctttcccgagcgcgcggccgag
ctggccgccgccgcgcaggcggacggcgccgacggcgagataccggccgatatggcagcg
gcagccgcggccgtggcaccgccgcccggcaagatctcgggccacgacgacgtgatccgc
cgcctcgacgagatctgtgagtattacgaacgaatcgagccgtccagcccgctgccgatc
ctgctcaagcgcgcgcggcgcctggtcggcaagagcttcgtcgaggtcctgcgggatatc
gcgccgggcgggctgtcggagttgcagacgctgtcggggcccgaggccgattga

DBGET integrated database retrieval system