KEGG   Burkholderia gladioli BSR3: bgla_2g10900Help
Entry
bgla_2g10900      CDS       T01464                                 

Definition
(GenBank) hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    bgla_2g10900
Enzymes [BR:bgd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     bgla_2g10900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer
Motif
Other DBs
NCBI-ProteinID: AEA63540
UniProt: F2LL62
Position
2:complement(1376345..1377019)
Genome map
AA seq 224 aa AA seqDB search
MANSRFRISFPLLFTLLLGGGMTAAMAEPASPAAHRVYTNADFYVDGVFQKEVAKDAIAQ
LAESYGQRITPEMRAQLWISDFGLHDFEHVGLTEMIWVNQQQYGYYAMTMYLLPNQMLPE
HRHMPIASPPARPAKHESWRVLHGWVYDFSEIGPKSAEIPAIPKSFGPVRSQNVVVQHEG
EVRQLKQLESWHFMMASPQGAIVDEYGNWQDHRGWFSSNPKVAP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcgaattctcgattcaggatttccttccccctgttattcaccctgctgctcggcggc
ggcatgacggccgccatggccgagcccgcgagccccgccgcgcatcgcgtctacacgaac
gccgatttctacgtggacggcgtattccagaaggaagtcgccaaggatgcgatcgcgcaa
ctggccgaatcctacggccagcgcatcacgccggaaatgcgcgcacagctctggatcagc
gacttcgggctgcatgacttcgagcacgtcgggctgaccgagatgatctgggtgaaccag
cagcaatacggttattacgcgatgacgatgtacctgctgccgaaccagatgctgcccgag
catcggcacatgccgatcgcctcgccgcccgcgcggcccgcgaagcacgagtcatggcgc
gtgctgcatggctgggtctacgatttctcggagatcgggccgaagtccgcggagattccc
gccatcccgaagagtttcgggccggtccgcagccagaatgtcgtggtccagcacgaaggc
gaggtccggcagctcaagcaactcgaaagctggcatttcatgatggcctcgccgcaaggc
gcgatcgtcgacgaatacggcaactggcaggatcatcgcggctggttcagctcgaatccg
aaagtcgcgccctga

DBGET integrated database retrieval system