KEGG   Burkholderia gladioli BSR3: bgla_2g15580Help
Entry
bgla_2g15580      CDS       T01464                                 

Definition
(GenBank) ABC transporter related protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    bgla_2g15580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgd02000]
    bgla_2g15580
Enzymes [BR:bgd01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     bgla_2g15580
Transporters [BR:bgd02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    bgla_2g15580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase AAA_30 AAA_25 Zeta_toxin SMC_N AAA_29 SbcCD_C MMR_HSR1 AAA_23 FeoB_N Dynamin_N
Motif
Other DBs
NCBI-ProteinID: AEA64003
UniProt: F2LM77
Position
2:1951983..1953497
Genome map
AA seq 504 aa AA seqDB search
MTNPPVVEMIDIDKAFPGVKALRRAGLRLFPGEIHALMGQNGAGKSTLINVLTGVHAHDA
GEIRVGGAPVRFAAPREAEAAGIQTLYQEINLCPNLSVAENMFAGRQPMRRGAIDWKTIH
ARSREALASLRLQIDVTRSLDAYPIAVQQMVAIARAMSVDARVLILDEPTSSLDDGEVAR
LFEVLRKLKAAGIAILFVTHFLEQTYAISDRITVMRNGEREGEYLARDLPVDALVARMTG
RESMPEALRAGAVAQARTGGDASPVLSMQGVGRRGMMNPLDLALRPGEILGLAGLLGSGR
TETARLAFAAERGDTGTIEIEGRRTRLASPHEAVRHGIAYCPEDRKKEGIVAALSIRENI
VLALQARRGWWRLIPRARQREIADDYIARLGIKARDAEQPIGLLSGGNQQKVLLARWLAT
DPKLLILDEPTRGIDVAAKFDIMERVLSLCARGLAILFISSEIGEVVRVSHRIAVLRDRR
KVAELTGAEASEEQVYRLIAGGQS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatccaccggtggtcgagatgatcgacatcgacaaggctttcccgggcgtgaag
gccttgcggcgtgccggcctgcggctctttccgggcgagatccacgccctgatgggccag
aacggggcaggcaagtccaccctgatcaacgtgctgaccggcgtgcatgcgcacgacgcc
ggggagattcgcgtgggcggcgcgcccgtgcgtttcgccgcgccgcgcgaggccgaggcg
gccggcatccagacgctctaccaggaaatcaatctgtgcccgaacctgtcggtggccgag
aacatgttcgccggccgccagccgatgcggcgcggcgcgatcgactggaagaccatccat
gcgcgttcgcgcgaggcgctggcgagcctgaggctgcagatcgacgtgacgcgctcgctc
gatgcctacccgatcgcggtgcagcagatggtggcgatcgcgcgcgccatgtcggtggac
gcgcgcgtgctgatcctcgacgaacccacctccagcctcgacgacggggaggtcgcgcgc
ctgttcgaggtgctgcgcaagctcaaggccgccggcatcgcgatcctgttcgtcacgcat
ttcctcgagcagacctatgcgatctccgatcgcattaccgtgatgcgcaacggcgagcgt
gagggcgagtacctggcgcgggatctgccggtcgacgccctggtggccaggatgaccggc
cgcgaatcgatgcccgaggcgctgcgcgcgggcgccgtcgcgcaggcgcgcaccggcggc
gacgcctcgccggtcctgtcgatgcagggcgtcgggcggcgcggcatgatgaacccgctc
gacctggcgctgcggcccggcgagattctcggactggccggcctgctcggctcgggccgc
accgaaaccgcccggctcgccttcgccgccgagcgcggcgataccggcaccatcgagatc
gagggccgccgcacgcggctcgcttcgccgcacgaggcggtccggcacggcatcgcctat
tgccccgaggatcgcaagaaggaagggatcgtcgccgcgctgtcgatccgcgagaacatc
gtcctggcgctgcaggcgcggcgcggctggtggcggctgatcccgcgcgcgcgccagcgc
gagatcgccgacgactacatcgcgcggctcggcatcaaggcgcgcgacgcggaacagccg
atcggcctgctctcgggcggcaaccagcagaaggtgctgctggcgcgctggctcgccacc
gacccgaagctgctgatcctcgacgagccgacgcgcggcatcgacgtggcggcgaagttc
gacatcatggagcgcgtgctgtccttgtgcgccagggggctcgcgatcctcttcatctcc
tcggagatcggcgaggtggtgcgcgtcagccatcggatcgcggtgctgcgcgaccggcgc
aaggtcgccgagctgaccggcgccgaagcctcggaggaacaggtctatcgcctcatcgcg
ggaggccagtcatga

DBGET integrated database retrieval system