KEGG   Burkholderia gladioli BSR3: bgla_2g15970Help
Entry
bgla_2g15970      CDS       T01464                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00361  Chlorocyclohexane and chlorobenzene degradation
bgd00625  Chloroalkane and chloroalkene degradation
bgd01100  Metabolic pathways
bgd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    bgla_2g15970
   00361 Chlorocyclohexane and chlorobenzene degradation
    bgla_2g15970
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     bgla_2g15970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AEA64042
UniProt: F2LN79
Position
2:1998119..1998823
Genome map
AA seq 234 aa AA seqDB search
MSLSATPRPQWLTFDCYGTLIQWDEGLQAAVGDILAGKGAHAVSSAELIAVYDRHEHALE
QTPPHRSFRELSGEALKLALREWRLDADDADARRLTDSISAMPPFPEVVEALRALKAAGY
RLCIVSNTDDDVIAGNVAQLGGTIDRVITAQQAGAYKPSRRIFEHAHRELGVTREQVVHI
CASPHLDHAAARELGFRCVWIDRGTGRALLPDYRPDATLATLDQVPALFDALGW
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctctccgctacgccccgcccccaatggctcaccttcgactgctacggcacgctg
atccagtgggacgaaggcctgcaggccgcggtcggcgacatcctcgccggcaagggcgcg
catgccgtgtcgagcgccgagctgatcgccgtctacgaccgccacgaacacgcgctcgag
cagaccccgccgcatcgctcgttccgcgagttgtcgggcgaggcgctgaagctcgcgctg
cgggaatggcggctggacgccgacgacgccgacgcgcggcgcctgaccgacagcatctcg
gcgatgccgccgttcccggaagtggtcgaggcgctgcgcgcgctgaaggcggccggctac
cggctctgcatcgtctcgaacaccgacgacgacgtgatcgccggcaacgtcgcccagctc
ggcggcaccatcgatcgcgtgatcaccgcccagcaggccggcgcctacaagccgagccgg
cgaatcttcgagcatgcgcatcgcgagctcggcgtgacgcgcgagcaggtggtgcatatc
tgcgccagcccgcacctggaccacgccgccgcgcgcgagctcggcttccgttgcgtgtgg
atcgatcgcggcaccggccgcgcgctgctgcccgactatcgccccgacgcgaccctcgcc
acgctcgaccaggtgccggcgctgttcgacgcgctgggctggtaa

DBGET integrated database retrieval system