KEGG   Burkholderia gladioli BSR3: bgla_2g16760Help
Entry
bgla_2g16760      CDS       T01464                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00430  Taurine and hypotaurine metabolism
bgd00460  Cyanoamino acid metabolism
bgd00480  Glutathione metabolism
bgd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    bgla_2g16760
   00460 Cyanoamino acid metabolism
    bgla_2g16760
   00480 Glutathione metabolism
    bgla_2g16760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bgd01002]
    bgla_2g16760
Enzymes [BR:bgd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     bgla_2g16760
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     bgla_2g16760
Peptidases and inhibitors [BR:bgd01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   bgla_2g16760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AEA64118
UniProt: F2LPS9
Position
2:2109019..2111013
Genome map
AA seq 664 aa AA seqDB search
MNKPRLLPYVSAVLAATLMGACGGDTETSAPAASTPPATTDSTCLAIDSSGSTAVVGSSQ
PGDPSLPEPASGYRKGLKPITAKSYLVATSNAYASAAGCAVLRKGGTAADAAVAVQAVLG
LTVPEATGLGSGGVLLYFDARNKTLQAYDGRETAPAAATENYLRYVDDTSDQSAPVPSAR
ASGRSIGTIGVPRLIELLQRDHGKLQWRDLFGDAISLASNGFPIGGRLAAAISSNAASLK
RDAEAAAYFLNADGSPKALGTVLKNPAYADALTQMAQNGANALYSGAIAQDIVAKIATTT
GADGSRITPGKTTLADLAAYQAKRRDAICTTYRGSYWVCGMPPPSSGGIAVASALGILEN
FDLKSMGPAAIDLEGGKPSVQGVHLITEAERLAYADRDKYVADTDFIPLPGGSADTMLNK
PYLKQRAALISTTRSMGTAQPGDLGAIPLGVDTTLIEHGTNQFTIVDGDGNVLSATTTVE
SSMGSFHMTHGFLLNNQLTDFSASPTDSNGALVANRVQPGKRPRSSMAPTIVFKVAADGS
KGDFVMATGSPGGGTIPQYVLKTLVGTLDWGLDAQQSAGLIDFGASNSPTTTIGGEHPNV
DTSNGGANDPLIAGLKALGHTVSTSAQASGVNTVLRIQRNGTNLLQGGTDPRREGVVLGD
TITP
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcccagactcctgccctacgtttccgcggtgctcgcggccacgttgatgggg
gcatgcggtggcgataccgaaacatccgcccccgccgcctccactccgcccgccaccacc
gattccacctgcctggcgatcgacagcagcggctcgaccgccgtggtcggctcgagccag
cccggcgacccgtccctgcccgagcccgcttccggctatcgcaagggcctcaagccgatc
accgcgaaaagctacctggtggccacctcgaacgcctacgcgagcgcggccggttgcgcg
gtgctgcgcaagggcggcaccgccgccgacgcggcggtggccgtgcaggccgtgctcggc
ctgaccgtgcccgaggcgaccggcctcggctcgggcggcgtgctgctgtacttcgatgcg
cgcaacaagacgctgcaggcctacgacggccgcgagacggcaccggccgccgccaccgag
aactacctgcgctatgtcgacgacaccagcgaccagtccgcgccggtgccgagcgcgcgc
gcgagcggccgttcgatcggcaccatcggcgtgccgcgcctgatcgagttgctgcagcgc
gaccacggcaagctgcaatggcgcgacctgttcggcgatgcgatctcgctggccagcaac
ggcttcccgatcggcggccggctggcggccgcgatctcctcgaacgccgcgagcctgaag
cgcgacgccgaggccgccgcctacttcctcaatgccgacggctcgccgaaggcgctcggc
accgtgctgaagaaccccgcctatgccgatgcgctgacgcagatggcacagaacggcgcg
aacgcgctctactcgggtgcgatcgcacaggacatcgtcgccaagatcgccaccaccacg
ggcgccgacggctcgaggatcaccccgggcaagaccaccctggccgacctcgcggcctac
caggccaagcgccgcgacgcgatctgcaccacctatcgcggcagctactgggtctgcggc
atgccgccgccgtcgtcgggcggcatcgcggtggcctcggcgctcggcatcctggagaac
ttcgacctgaagtcgatgggcccggcggcgatcgacctcgaaggcggcaagccgagcgtg
cagggcgtgcacctgatcaccgaggccgagcgcctggcctatgccgaccgcgacaagtac
gtggccgacacggacttcatcccgctgcccggcggcagcgccgacaccatgctgaacaag
ccctacctgaagcagcgggcggccctgatcagcaccaccaggagcatgggcacggcgcag
cccggcgatctcggcgcgattccgctcggcgtcgataccaccctgatcgagcacggcacc
aaccagttcaccatcgtcgacggcgacggcaacgtgctgagcgcgaccaccacggtggag
tcgagcatgggttcgttccacatgacgcacggcttcctgctcaacaaccagttgaccgac
ttctccgcctcgcccaccgacagcaacggcgcgctggtcgcgaatcgcgtgcagccgggc
aagcggccgcgcagctcgatggcgccgaccatcgtgttcaaggtcgcggcggacggctcg
aagggtgatttcgtgatggcgaccggctcgcccggcggcggcacgatcccgcaatacgtg
ctgaagacgctggtcggcacgctcgactgggggctcgacgcgcagcagtcggccgggctg
atcgacttcggcgccagcaacagcccgaccaccacgatcggcggcgagcatccgaacgtc
gacaccagcaacggcggcgcgaacgatccgctgatcgcggggctcaaggcgctcggccac
accgtctcgacctcggcgcaggccagcggcgtgaacaccgtgctgcgcatccagcgcaac
ggcacgaacctgctgcaaggcggcaccgatccgcgtcgcgagggggtggtgctgggggat
accatcacgccctga

DBGET integrated database retrieval system