KEGG   Burkholderia gladioli BSR3: bgla_2g19140Help
Entry
bgla_2g19140      CDS       T01464                                 

Definition
(GenBank) Non-hemolytic phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00562  Inositol phosphate metabolism
bgd00564  Glycerophospholipid metabolism
bgd01100  Metabolic pathways
bgd01110  Biosynthesis of secondary metabolites
bgd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    bgla_2g19140
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    bgla_2g19140
   00565 Ether lipid metabolism
    bgla_2g19140
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    bgla_2g19140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bgd02042]
    bgla_2g19140
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     bgla_2g19140
Bacterial toxins [BR:bgd02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   bgla_2g19140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal UCR_Fe-S_N
Motif
Other DBs
NCBI-ProteinID: AEA64350
UniProt: F2LQ04
Position
2:2428721..2430910
Genome map
AA seq 729 aa AA seqDB search
MSTYNRRRFLQTAASTAGAAAALTVFPDAIRKALAIPAASGTGSIRDVQHVVVLMQENRS
FDHYFGHLRGVRGYNDRFPIPLASGQPVWFQPSKANPQTPVLPFRYDVNKISECLGDLDH
SWYPTHNAINNGRMDAWPANKSDLTMGYHVREDIPFHYALADAFTICDHYFCSMPGPTHP
NRTYLMTGMVDPTGKQGGPLLDNNDAVDNDLPPKWDLLTWTTYPERLQAAGISWQLYQQG
VNGNDPVNGNYGTNMLPNFANFINAPAGSALQTRGNAVRTLVDLKNDVLANQLPQVSWLC
PPAIYSEHPSYTPAYGATYIAQILDALTANPEVWSKTAFFLMYDENDGFFDHIAPPQPPT
NRAQGLSTVDVSAEIHNVVNPLRGGSYTADNLPYGMGPRVPMIVISPWTKGGYVNSQVFD
HTSVIRFIEQRFGVMEPNISPWRRAVSGDLLSCFDFSTPDAAFPTLPNTSNYQAMSDASC
QNPKAVVPAVPSPSSIKAQEAGVRAARALPYELHANGRELTKDNEFQINFSNTGKVGASF
YVYATNRGDGPWRYTVEAGKSIADTFNLAGTDGVYNFLVYGPNGFVRQFVGAIPQDKKTR
NKSAKPVVVVGYDAANGNVMLKISNKGAKAVKLSVTDNAYGAQTRHFSIPSEGFVEEVWT
LKHSHQWYDLTVSDGAAFAWRAAGHVENGKSSFSDPAATQVVTELPSSITASPTAIAMQD
LDLPDRLDA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgtctacctacaatcgacgacgcttcctgcagaccgccgcctcgacggccggcgcagcc
gctgccctgacggtgttccccgatgcgatccgcaaggcgctcgccattcccgcggcttcc
ggcacgggttcgatccgggacgtgcagcacgtcgtggtgctgatgcaggaaaaccgctcg
ttcgaccattacttcggccacctgcgcggcgtgcgcggctacaacgaccgcttcccgatc
cccctggccagcggccagccggtctggttccagccgtccaaggccaacccgcagacgccg
gtgctgccgttccgctacgacgtcaacaagatcagcgagtgcctgggcgacctggaccac
agctggtacccgacccacaacgccatcaacaacggccgcatggacgcctggccggccaac
aagtccgacctgacgatgggctaccacgtgcgcgaggacatccccttccactacgcgctg
gccgacgcgttcacgatctgcgatcactatttctgctcgatgccggggccgacgcacccg
aaccgcacctacctgatgaccggcatggtggacccgaccggcaagcagggcggcccgctg
ctggacaacaacgacgcggtcgacaacgacctgccgccaaagtgggacctgctgacctgg
accacctacccggagcgcctgcaggccgccggcatctcctggcagctctaccagcagggc
gtgaacggcaacgatccggtgaacggcaactacggcaccaacatgctgccgaacttcgcc
aacttcatcaacgcgccggccggctccgcgctgcagacgcgcggcaacgcggtgcgcacc
ctggtcgacctcaagaacgacgtgctggccaaccagctgccgcaggtctcctggctgtgc
ccgccggcgatctattccgagcatccgagctacacgccggcctacggcgcgacctacatc
gcccagatcctcgacgcgctgaccgcgaacccggaggtgtggagcaagaccgccttcttc
ctgatgtacgacgagaacgacggcttcttcgaccacatcgccccgccgcaaccgccgacc
aaccgcgcccagggcctgtcgacggtggacgtgagcgccgagatccacaacgtggtgaac
ccgctgcgcggcggcagctacacggccgacaacctgccctacgggatgggcccgcgcgtg
ccgatgatcgtgatctcgccctggaccaagggcggctacgtcaactcgcaggtgttcgac
cacacctcggtgatccgcttcatcgagcagcgcttcggcgtgatggagccgaacatcagc
ccgtggcgccgcgccgtgtcgggcgacctgctgagctgcttcgacttcagcacgccggac
gccgcgttcccgacgctgccgaacaccagcaactaccaggcgatgtccgacgcgtcctgc
cagaaccccaaggcggtggtgccggcggtgccgagccccagctcgatcaaggcgcaggaa
gccggcgtgcgcgcggctcgcgccctgccctacgagctgcacgccaacggccgcgaactc
accaaggacaacgaattccagatcaacttctcgaacacgggcaaggtgggcgcgagcttc
tacgtgtacgccaccaaccgcggcgacggcccgtggcgctacacggtggaggccggcaag
tcgatcgccgacaccttcaacctggccggcacggacggcgtctacaacttcctggtgtat
ggcccgaacggtttcgtgcgccagttcgtcggcgcgatcccgcaggacaagaagacccgg
aacaagtcggccaagccggtggtggtggtgggctacgacgcggccaacggcaacgtcatg
ctgaagatcagcaacaagggggccaaggccgtgaagctgtccgtcacggataacgcctac
ggcgcgcagacgcgccacttctcgatcccgtcggaaggtttcgtcgaggaagtctggacg
ctcaagcacagccaccagtggtacgacctgaccgtctccgacggcgcggccttcgcctgg
cgcgccgccggccacgtggagaacggcaagagcagcttcagcgatccggccgccacgcag
gtggtgacggagctgccgagctcgatcaccgcctcgccgacggcgatcgcgatgcaggac
ctggacctgccggacaggctcgacgcctga

DBGET integrated database retrieval system