KEGG   Burkholderia gladioli BSR3: bgla_2p0190
Entry
bgla_2p0190       CDS       T01464                                 
Name
(GenBank) hypothetical protein
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgd02044]
    bgla_2p0190
Secretion system [BR:bgd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   bgla_2p0190
SSDB
Motif
Pfam: TraF Thioredoxin Redoxin AhpC-TSA Thioredoxin_2 DSBA
Other DBs
NCBI-ProteinID: AEA65617
UniProt: F2LS62
Position
bgla_2p:complement(25262..26071)
AA seq 269 aa
MTRLHYVGLAIASTIAAMAIMSSNADAAGGDYPSAWQCDGQAKFNWYCDDEKPAAPAAAS
APKPADTDDFDKIKSADEMREMLKHRLDVATMDPTPANIKSYIKLWQFVQNKSAVFADVW
RRDVWQDPSLDYSLKRPTNNVAVHTYDQARDSDQDAQLRALAEKHGLIFFFRSDCPYCHA
MAPTIQLLAQRYGIDVLPVSLDGRGIPGFPSPTPDQGQAATWGVQQVPALFIASKETGDH
AMIGSGTLSLQDIIDRIFVLTASKPGELF
NT seq 810 nt   +upstreamnt  +downstreamnt
atgacacgtctgcactatgtcggcctcgcgattgcgagcacgatcgcggctatggcaatc
atgtcgtcgaacgcggacgccgctggaggcgattatccgtccgcctggcaatgcgacggc
caggcgaaattcaactggtattgcgacgacgagaagcctgctgcgccggcagcggcgagc
gcgccgaagccggcggatacagacgacttcgacaagatcaagtcggccgacgagatgcgt
gagatgttgaagcaccggctcgacgtcgcgaccatggaccccacgccggcaaacatcaag
tcgtatatcaagctctggcagttcgttcagaacaagagtgcggtgttcgcggacgtctgg
cgtcgcgatgtttggcaggacccgagcctcgattactccctcaagaggccgaccaataac
gtggcggtgcatacctatgaccaggcccgagactcggaccaggatgcccagctgcgcgcg
cttgctgagaagcatggcttgattttcttcttccgctcggactgcccgtactgccatgcg
atggcgcccacgatccagttgctcgcccagcgctatggcatcgacgtgctgccggtctcg
ctcgacggccgcggcatcccgggatttccgagccccacgccggaccaggggcaggccgcg
acctggggcgtccagcaggtgccggcgctcttcatcgcgtcgaaggagaccggcgaccac
gccatgatcggctccggaacactgtccctccaagacatcatcgatcgcatcttcgtcctg
acggcctcgaagccgggggagctcttctaa

DBGET integrated database retrieval system