KEGG   Burkholderia gladioli BSR3: bgla_3p0540Help
Entry
bgla_3p0540       CDS       T01464                                 

Definition
(GenBank) conjugal transfer protein TraN
  KO
K12058  conjugal transfer mating pair stabilization protein TraN
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgd02044]
    bgla_3p0540
Secretion system [BR:bgd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   bgla_3p0540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraN
Motif
Other DBs
NCBI-ProteinID: AEA65755
UniProt: F2LSF9
Position
bgla_3p:complement(70554..73271)
Genome map
AA seq 905 aa AA seqDB search
MSTASQWLRSRRQYRKRRQLFRRMVCAAVSVSLLFADVSIAYADSFSDGQNILLGSQGTT
NFVGMGNGIATGTVNYGQGGQGNCDTTKGTVCANDVLPSSYGQGNLSQFTSQYGGTNNAG
NVQSAGYQQQLNDKTAGASGNGTTPTQWLDYSANQGASSRNFGTSIGSTASDNLTQISQG
TDPSGSANTLAGIMPSCTSTTDASGNVHQSCTGVVQCLGNSCYNPQAESNSDFGSFAAAA
QIINGMKSGMVCAETGKAPSQANTCTPYETQVVTGYTQDPNQPDCSTCTVPVYKTEDYCK
ETGKSVQITCNGGSPQDLDGVIPGDIPSGCQLYTPPPNTDSYPAQCTPTVFVGEVNACSN
YVGSGVGLTNDCCAQGAQSASALSLTSLIALSDMIPQVQQLKAQLAQQVESALSPLTNAV
KDIGSDLSDFAGQIEGGLSNMVSSGSVGAGFECMADGTGAGTEINAAASLSANGSSQGIT
SGIQQFVQNQLTNMVGQQTAQELMQAYQYFNYAMTAYTIAATIGGLATKCSTDELQMGVK
QKNKECVTMPEYCATSGGFTCLQYTTKACCYGSMISRVLAQQIKAQLNPGVANGGYGASD
NPDCSGFSPQQLAQVDWSKVDLSEWLATLNETGYSLPQTASQVNAAESGSTSLTSYYEPG
TAPTTNQVQNSVVRANQLTSGGVMEASRANATLTQPTCYTDPTGIPTYSKAIEPTDVIKA
EGAVQSDYGFDQITSCTPTAGAHCMQINLGKQGDNYLNDSCSRIWRQLYNFNVLRPDLIV
SARLMEVEWDDHIDIKINGQDVFTSPDFYTNAYFVPGGVCDLKTSWNALSAPGSGQTEWN
PPGLNPPGPPTFVDLTTQFQHGGMIDTETDLIVGGGGEGDAFIQIQYNDPPNQTPTNCIS
PPNPQ
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggcttcccagtggcttcggagtcgtcggcagtatcgcaaacgtcgccagctg
tttcgacgcatggtgtgcgcagcggtcagtgtcagtctgctcttcgcggacgtgagcatc
gcctatgccgactcgttttcggacgggcagaatatcctgctcggttcacaaggcacgacc
aatttcgtcggaatgggcaacggcatcgctaccggtaccgtcaactacgggcagggcggc
cagggaaactgtgacaccacgaaggggactgtctgtgcgaacgatgtcctaccgtcgagc
tacgggcaaggcaatctgagccagttcacctcgcaatacggtggtacgaacaacgccggc
aacgtccagtcagccgggtaccagcagcagttgaacgacaagacggcgggagcgagcggc
aatggcacgacgccgacgcagtggctcgactactcggcgaaccagggtgcaagttcgcgt
aacttcggcacgtcgatcggctccactgcctcggacaacctgacgcagatcagccaaggc
acggatccgtccggctcggcaaacacgctcgctggcatcatgccatcgtgcacgtcgacc
acggatgccagtggcaacgtgcaccaaagctgcacgggcgtcgtgcaatgtctcggtaat
agctgttacaacccgcaggccgagtccaattcggacttcggcagctttgcagccgcggcc
cagatcatcaacggtatgaagagcgggatggtctgcgcggaaaccggtaaggccccaagc
caggcaaacacctgtacgccatacgaaacgcaggtggtgaccggttatacgcaagacccg
aatcagccggattgctcgacctgcaccgtacccgtgtataagaccgaggattattgtaag
gaaaccggcaagtccgttcagatcacatgcaatggcggttcgccacaagatctcgacggc
gtcattccgggagacattccgtcgggctgtcagctctatacaccaccaccgaataccgat
agctatccagcgcagtgcacgccgaccgtattcgttggggaagtgaacgcatgctcgaac
tacgttggctctggcgtgggtctgactaacgactgctgcgcgcagggggcgcaatcggcg
agcgcgctgagtctgacgtcgttgatcgcgctctccgacatgatcccgcaggttcagcag
ctgaaagcacagttggcccagcaggtcgagtcggcactgagcccactgactaatgcggtc
aaggacatcggttccgacctcagtgacttcgcgggtcaaattgaggggggcttatcgaac
atggtgtcatcgggttccgtcggggccggcttcgaatgtatggctgacggcacaggtgct
ggtaccgaaatcaacgcggctgcgagcctttctgcaaacggtagctcgcaggggattacc
tcgggcatacagcaattcgttcaaaatcagctgacaaacatggtcgggcagcaaactgcc
caagagctgatgcaggcctatcaatatttcaactacgcgatgaccgcatacacgatcgcc
gcaacgatcggcggtctggcgacgaagtgctcgacggacgagctgcaaatgggcgtgaag
cagaagaacaaggagtgcgtcacgatgccggagtactgtgcgacgagcggcggctttacc
tgtctgcagtacacgaccaaggcctgttgctatggctcgatgatttcacgcgtgctcgcg
cagcagatcaaagcgcagttgaacccgggcgtggccaacggcggctacggcgcttcggat
aaccctgattgcagtggtttctcacctcagcaactggctcaggtcgactggagcaaggta
gatctctccgaatggctcgccactctaaacgaaacgggctacagcctgccgcagaccgcc
tcgcaggtcaatgcagccgagtcgggttctacgagcctcacgagctactatgagcccggt
acggccccgaccacgaatcaggtacagaactcggtggtacgggccaatcagctgacctct
ggcggcgtcatggaggcttcgcgcgcaaacgccacgctcacgcagccgacctgctatacg
gacccaacgggtatcccaacgtattccaaggcaattgagccgaccgacgtgatcaaggcc
gaaggagccgtgcagtccgattacggtttcgaccaaatcacgagctgcacgccgaccgcg
ggtgcgcactgcatgcaaatcaacctcggcaagcaaggtgacaactatttgaacgactcg
tgttcgcggatctggcggcaactctacaactttaacgtgttgcggcccgacctgatcgtg
agcgctcgcctcatggaggtcgagtgggacgatcacatcgacatcaagatcaacggccag
gacgtcttcacgtcgcctgacttttacaccaacgcctatttcgtgcctggcggggtgtgc
gatctcaagacgtcgtggaacgcgctgtccgcgcccgggagcggacagacggaatggaac
ccaccaggcttgaatccccccgggccgccgacgttcgtcgatcttacgactcagttccag
catggcgggatgatcgataccgagacggacctgatcgtgggtggtgggggcgaaggggat
gcgtttatccagatccagtacaacgatccaccgaaccaaacgccgacgaactgtatttcg
ccgccgaatcctcaataa

DBGET integrated database retrieval system