KEGG   Burkholderia gladioli BSR3: bgla_3p0560Help
Entry
bgla_3p0560       CDS       T01464                                 

Definition
(GenBank) Type-F conjugative transfer system pilin assembly protein TrbC
  KO
K12061  conjugal transfer pilus assembly protein TraW
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgd02044]
    bgla_3p0560
Secretion system [BR:bgd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   bgla_3p0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC_Ftype
Motif
Other DBs
NCBI-ProteinID: AEA65757
UniProt: F2LSG1
Position
bgla_3p:complement(74636..75850)
Genome map
AA seq 404 aa AA seqDB search
MTGFAAAVAMYALSNTEAHAQDVPAGAIDSGLAATLGAQRDALATNAKALLAPVLGQVPQ
LSQDVPPQVLDAAQKLLDPSKKYVVQNLSAGQGNPDADSMASLKTVIFISESMPHATLQA
LFAQASGRKDVAFILRGWTPPKFRELIGAIKKDMPKGKPEANVFIDPQAFEQYGVDIVPV
TIHERSSNHHWYQITGEISVDGAIDQIEHGHAGRVVGNTYPVAEPDILAVIRERMRRVDW
NKQIKHAVDDARQAPFNGVEMPVSTKTASHLFDPSVTLSRDVTNPANGQIIAARGTRINP
LQMQAFPYTVIAFDPYDPLQLRWAAEVVKRNPNTLAYVTRNAMHSDGRATWDVIGTRTFT
LDEKAASRFDIESVPTMVRQEGLSMRVSTYTPASLAAAVQHTGN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ctgactggcttcgccgcggcagttgccatgtatgcgctatcaaataccgaggctcatgcg
caggacgtgccggcgggcgcaatcgactcgggtctggcggcgacgctcggcgcgcagcgc
gacgcgcttgccaccaatgcgaaggcgctgctcgctccggtgctcggccaggtgccccag
ttgtcgcaagatgtgccgccgcaggtgctcgacgccgcacagaagctcctcgatccgtcg
aagaaatacgtcgtgcagaacctctcagctgggcagggcaaccctgatgccgattcgatg
gcctccctcaagacggtcatcttcatttccgaatcgatgccgcacgcaacgctgcaggcg
ctttttgcgcaggcctctggacgcaaggatgtcgccttcattttgcgtggctggacgccg
ccgaagttccgcgagttgatcggcgcgatcaaaaaagacatgcccaagggtaagcccgag
gccaacgtttttatcgacccgcaggcgttcgagcagtatggcgtcgacatcgtgccggtc
acgatccacgaacgcagctcgaatcaccactggtatcagatcacgggcgagatttcggtt
gacggtgccatcgaccagatcgaacacggccatgccggccgtgtggtcggcaatacctat
ccggtggccgaacccgacatcctcgcggtcattcgcgagcgcatgcgccgcgtcgactgg
aacaaacagatcaagcatgccgtggacgatgcacgccaagcaccgttcaacggcgtagag
atgccggtgtcgacgaagacggcaagccatctatttgatccgagcgtgacactctcgcgc
gatgtgacgaacccggctaacggccagatcatcgctgcgcgaggcacgcgcatcaatccg
ctgcagatgcaagcgttcccgtatacggtcatcgccttcgatccgtacgaccccttgcag
ctgcgctgggcggcagaggtcgtgaagcgcaacccgaacacacttgcctatgtgacccgc
aacgccatgcattcggacggccgcgcgacgtgggacgtgatcggcacgcgtaccttcacg
ctcgacgagaaggccgcgagccgcttcgatatcgagagcgtgcccaccatggttcgccag
gaaggcctgtccatgcgcgtaagtacgtacaccccggcttcgctcgccgcagccgtccag
cataccgggaactga

DBGET integrated database retrieval system