KEGG   Burkholderia gladioli BSR3: bgla_3p0600Help
Entry
bgla_3p0600       CDS       T01464                                 

Definition
(GenBank) sex pilus assembly protein TraV
  KO
K12064  conjugal transfer pilus assembly protein TraV
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgd02044]
    bgla_3p0600
Secretion system [BR:bgd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   bgla_3p0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraV
Motif
Other DBs
NCBI-ProteinID: AEA65761
UniProt: F2LSG5
Position
bgla_3p:complement(80496..81320)
Genome map
AA seq 274 aa AA seqDB search
MLNRFNRLVRAVRPSVIAAVAISLGGALSGCASMWSVGSTQYDCPGIPNGVVCKTPREVY
EATNHRNALITMDDDGKQRGANSGMGNTAGDDRDGALGAHANVTLPQPIQQPLPILEPAK
VMRIWVNSWIDQNGDLHYPGLIFTEITARRWAVGNIVAGVEGQVLTPVQVDNNGSSVNAG
ATDAATGTDSHVVGKPDAVIQPYAKSDTGAGSSGASSGPSIPGMPIPDASTSGGMGGGNS
SPFSTNFSSSSGGANFRPTTNWNARGSMGNSGFN
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatcgatttaatcgccttgtgcgagcagtgcgccccagtgtgatcgctgctgtc
gcgatctcactcggcggggcgctctccggatgcgcttcgatgtggagtgtcggctcgacg
caatacgactgcccgggtattccgaacggcgtggtctgcaagaccccacgtgaagtctac
gaggcgacgaaccatcgcaacgcgctcatcacgatggacgacgacggcaagcaacgcgga
gccaatagcggcatgggcaacacggcaggggatgatcgcgatggcgcgctcggtgcgcat
gcgaatgtgacgttgccacagccgatccagcaaccgctgccgattcttgagccggccaaa
gtgatgcggatctgggtcaattcgtggatcgatcagaacggcgacctgcattatccgggc
ctcatctttactgagatcacggctcgccgctgggcagtcggcaacattgtcgcaggcgtg
gaaggccaggtgctcacgccggttcaagtcgacaacaacggctcgagcgtcaacgcgggg
gcaactgacgcggcaaccggtaccgattcgcacgtggtcggaaagccggatgcagtgatc
cagccgtacgccaagtccgataccggtgcgggaagttcgggtgcgtcgtcgggcccgagc
atccccggcatgccgattccggatgcatcgacgagcggcggtatgggtgggggtaatagc
tcaccgttctcgacgaacttttcgagcagctcgggcggtgccaatttccgtccgacgacg
aattggaacgcccgcggaagtatgggaaatagcggcttcaattga

DBGET integrated database retrieval system