KEGG   Burkholderia gladioli BSR3: bgla_3p0700
Entry
bgla_3p0700       CDS       T01464                                 
Name
(GenBank) sex pilus assembly protein TraF
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgd02044]
    bgla_3p0700
Secretion system [BR:bgd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   bgla_3p0700
SSDB
Motif
Pfam: TraF Thioredoxin_2
Other DBs
NCBI-ProteinID: AEA65771
UniProt: F2LSH5
Position
bgla_3p:90525..91589
AA seq 354 aa
MLMDGRKISKRLAKQPLRLAEGMRAFAPVAVKAALAFSVIGLTGASAPANAQMASGNDLS
YFQGKNDGWFFYNDPKPQKKVQPPPPPPPQPVAATPAQPASAPPEPLSVAWLREKMPILR
DNAINNPTPENVKAYLATQRVMLDMAQDFANTANKVATTDPYLSENFRLPQATFASRETR
FLIAKAKNQIIDNVAQHAGLWFFFDSKCTFCQLQYETLTKVKKNTKFVVRYISTDGAPLP
GMKSGDFVADQNQRVFRSLGLKLTPAVVLAWPPNKYLIVAQGAMDEGGLYDKIVLAVTDQ
NLVPKSLTDAVNLEQRGILTPKDLATLRSTNADTDDPKVLVKMIENAIDGRLQQ
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgcttatggacggcagaaagatttcaaagcggcttgcgaagcaacccctacggctagcg
gaggggatgcgcgcattcgccccggttgccgtcaaggcggcattggcgttttcggtcatc
gggttgaccggggcatctgcgcccgccaacgcgcagatggcgtcgggcaacgatctctcg
tatttccaggggaaaaacgacggctggttcttctataacgatccgaagccgcagaaaaag
gtccaaccgcccccacctcccccgccgcagccggttgcagcgacaccagctcagccagcg
tctgctccgcccgaaccgctgtcggtcgcctggttgcgggaaaaaatgccgatcctgcgc
gacaacgcgatcaacaacccgacgccggagaacgtgaaggcgtatctcgcaacgcagcgc
gtcatgcttgacatggcgcaggacttcgccaatacggcgaacaaggtagctactaccgac
ccttatctcagtgaaaacttccgtctgccgcaggcgacgtttgcctcgcgcgaaacgcgc
ttccttattgccaaagcgaagaatcagatcatcgacaacgtggcgcagcacgcggggttg
tggttcttcttcgatagcaagtgcacgttctgccagttgcaatacgagacgctcacgaag
gtcaagaagaacacaaaattcgtggttcgctacatctcaacagatggcgcaccgctgccc
ggtatgaagtcaggtgatttcgtggcggaccagaaccagcgcgtgttccgctcgctcggc
ctaaagctcacgccggccgtcgtcttggcttggccgccaaacaagtacctcatcgtcgca
caaggcgcgatggatgagggcggcctctacgacaagatcgtgctggccgtgacagaccag
aatctggtcccgaaaagcctcaccgatgctgtgaatcttgagcagcgcgggatcctgacg
cccaaggatctggcaacgctgcgcagcactaacgccgataccgacgatccgaaggtcctc
gtcaagatgatcgagaacgcgatcgacggccgcctgcagcagtaa

DBGET integrated database retrieval system