KEGG   Burkholderia gladioli BSR3: bgla_4p2340Help
Entry
bgla_4p2340       CDS       T01464                                 

Definition
(GenBank) OmpA/MotB domain protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    bgla_4p2340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgd02044]
    bgla_4p2340
Secretion system [BR:bgd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bgla_4p2340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU OmpA
Motif
Other DBs
NCBI-ProteinID: AEA65996
UniProt: F2LSX6
Position
bgla_4p:complement(247556..248821)
Genome map
AA seq 421 aa AA seqDB search
MTISKIDSRNYAGVLASPPLSARLKAALQSVNPLLESARVLLLALADTPAALEPDAVLQR
RKWLEQELRMFLRVCRDLQLPSDDVVRASYCLSTALDEAAMQTRWGRGEGTGTEWQASSL
AVAMGHDRQGGDRVFHVIDEVLNDPRGHLDLLELLQNVLDLGFRGRYRFERDGPRRLLNI
HERVHGVVMAGEQGAAPVVDEDHTASRFASSDRVRGTVVSRGRLVDPWVRPARARRSRWW
IDVGVVAVLLVGAAGYVAVRELRHADQSAQASSPIDRLGAALGEQLRDEIAAGNVELIKD
TAADTVTLRFNGMYASGDVTVAPWWASVMASVGRAIASSPATTHVLITGYTDNLPASPAH
QGSNHALSTARAQQVAQIFAVAGVPKERISVVGQSDADPLADNVSKEGRARNRRVEVTVS
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatttcgaaaatcgactcgcgaaactacgccggagttctggcgtcgccgccgctc
agcgcgcgactcaaggcggcgttgcaatcggtcaatccgttgcttgaatccgcacgcgtc
ttgctgctcgcgctggcggatacgcccgccgcactggaaccagacgccgttttgcagcgg
cgcaaatggcttgagcaggaattgcggatgtttttgcgggtttgtcgcgatctgcagctg
ccgtcggacgatgtcgtgcgggcgagctattgcctcagcaccgcgctcgacgaggctgcg
atgcaaacgcgttggggacggggcgagggcactggaaccgaatggcaggccagcagtctc
gcggtggcgatgggccacgatcgacaaggcggcgatcgcgttttccacgtgatcgacgag
gtgctgaacgacccgcgcggacatctcgacctgctcgagctgttgcagaacgtccttgat
cttggctttcgcgggcgataccgcttcgagcgcgatggtccgcgacggctgctgaacatc
cacgagcgcgtgcacggcgtggtaatggcaggagagcagggcgcggcccccgttgttgat
gaagaccatacggccagtcgcttcgcctcatccgatcgtgttcgcgggacggtcgtttcg
cgcgggcgcttggtcgatccgtgggtgcgtccggctcgcgcgcgtcggtcacgctggtgg
attgacgtcggtgttgtggcagtgctgttggtgggcgcggcagggtacgtcgcggtcagg
gagttgcgccacgcggatcagtccgctcaggcgtcgtccccgatcgatcgattgggcgct
gcgttgggcgagcagctgcgcgacgaaattgccgccggcaatgtggagttgataaaggat
acggcggccgacacggtgacgctcagattcaacggaatgtatgcgtcgggcgacgtgacg
gtggccccatggtgggcgtccgtgatggcatcggtcggacgggctatcgcgagctcgccg
gctaccacccacgtgctcatcaccggatacaccgacaacctgccagcgagtcccgcccat
cagggttcgaatcacgcgctgtccacagcccgcgcccagcaagttgcgcagattttcgcg
gtggccggcgtgccgaaggaacgcatcagcgtggtgggccagagcgatgccgatccactg
gccgataacgtgtcaaaggaagggcgggcgagaaaccgtcgcgtcgaagtgaccgtgtcg
aattga

DBGET integrated database retrieval system