KEGG   Burkholderia gladioli BSR3: bgla_4p2410
Entry
bgla_4p2410       CDS       T01464                                 

Definition
(GenBank) type VI secretion protein, family
  KO
K11901  type VI secretion system protein ImpB
Organism
bgd  Burkholderia gladioli BSR3
Brite
KEGG Orthology (KO) [BR:bgd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgd02044]
    bgla_4p2410
Secretion system [BR:bgd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   bgla_4p2410
SSDB
Motif
Pfam: T6SS_VipA Nif11
Other DBs
NCBI-ProteinID: AEA66003
UniProt: F2LSY3
Position
bgla_4p:complement(258307..258849)
AA seq 180 aa
MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKHPSEPLPAVTD
RRFLEIDIDNFDERMKAIRPRVAFAVPNTLTGEGQMMVDMTFESMEDFSPAAIARKVEPL
RQLLEARTQLANLQTYMDGKSGAEALVTQLLQDPALLKSLAAAPKPERHDAGAADPSEAN
NT seq 543 nt   +upstreamnt  +downstreamnt
atgtccgcttccagcagttcgcaaaagttcatcgcgcgtaatcgtgcgccgcgcgtgcaa
atcgagtacgacgtcgaggtctacgggtcggagaagaaggtcgagctgccgttcgtgatg
ggcgtgctggccgatctgtccggcaagcatccctcggagccgcttcctgccgtgacggac
cgacgattcttggaaatcgatattgacaatttcgatgagcgcatgaaggccatccggcca
cgcgtcgcgttcgcagtgccgaatacgctgacgggcgaaggccagatgatggtcgacatg
acgttcgagagcatggaggacttttcgccggcggccatcgcccgcaaggtcgagccgctg
cgtcagctgctggaagcgcgcacgcaactcgccaacctgcaaacgtacatggatgggaag
tcgggtgcagaagcgctcgtcacgcaactgctgcaggaccccgcgctgctcaagtcgctg
gctgcggcaccaaagcccgagcgtcatgacgcgggtgcggcggacccgagcgaagcgaac
tga

DBGET integrated database retrieval system