KEGG   Burkholderia gladioli BSR3: bgla_4p3110Help
Entry
bgla_4p3110       CDS       T01464                                 

Definition
(GenBank) Peptidase M20
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bgd  Burkholderia gladioli BSR3
Pathway
bgd00300  Lysine biosynthesis
bgd01100  Metabolic pathways
bgd01120  Microbial metabolism in diverse environments
bgd01230  Biosynthesis of amino acids
Module
bgd_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bgd00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    bgla_4p3110
Enzymes [BR:bgd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     bgla_4p3110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AEA66062
UniProt: F2LTB6
Position
bgla_4p:334054..335181
Genome map
AA seq 375 aa AA seqDB search
MSPVIELTRALIAQNTIDPPGNEARAARVIADCLRANGIDPLVYEVAPGRTNLVARIHGN
GKRPSLAFSAHFDTIGVEPEQWSIDPFAGDIRNGRLYGRGSADMKGGMAAMTIAALELHR
GAARLEGDLLLTFSAAENSNCLGARRLLDDGYFAGVGALLISEPTGNRAFITEKGALWLR
ATAHGEYGHNAFSEHRGGDRGNAIVRLARYLDQVHDLRLPAPVHRHVGPPTINIGMIRGG
LSTPLIPAQASADIDVRLVPGQSPESVLAAFRSIAGHHVTIETLDLKLPVDTPDAHPFVL
QCLEACRVEGVRDPGPAGVGYYSDGAVIAPSLDLPMVIIGPGEVGMSGAPDEYVDINNLD
ASVRIFERVARAYLE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgtcatcgagctaacccgcgcgctcatcgcgcaaaacacgatcgatccgcct
ggcaatgaagcacgagccgcgcgcgtgatcgcggattgcttgcgcgccaacggcatcgac
ccgctcgtctacgaggtggcgccggggcgcaccaacctcgtggcacggattcatggcaac
ggcaaacgcccatcgctggcattctccgcacacttcgacacgatcggggtagagcccgaa
caatggagcattgatcccttcgcgggcgacatccggaatggccgcctctacggccgcggc
tccgccgacatgaagggcggcatggcggcaatgaccatcgcggcgctggagctgcaccga
ggcgccgcgcgactcgagggagatctgctgctgaccttttcggccgccgagaattcgaac
tgcctcggcgcgcggcggctgctcgatgacggttactttgccggcgtcggagcgctgcta
atctcagagccgacgggcaatcgggccttcatcaccgagaaaggcgccctgtggctccgc
gcaacagcgcacggcgaatacgggcacaacgccttctcggagcaccgcggtggcgatcgc
ggcaatgccatcgtgcgcctcgcccgctatctcgaccaggtacacgacctgcgcctgcct
gcgcccgtgcatcgtcatgtcggcccgccaaccatcaacatcggcatgatccgcggcgga
ctgtcgacaccgctgatccccgcccaggcctcggccgacatcgacgtgcggctggtgccg
ggacaatcgcccgaatcggtgctcgcggcgtttcgctccatcgccggccaccacgtcacg
atcgagacgctcgatctcaagcttccagtggacaccccggacgcacatcccttcgtcctg
cagtgcctcgaggcctgccgagtggaaggcgtgcgcgatcccggtcccgccggcgtcggc
tattactcggatggggccgtgatcgcgccttcccttgatttgccaatggtcatcatcggc
ccaggcgaagtcggcatgagcggcgcacctgacgagtacgtcgatatcaacaatctcgac
gcttcggtccgtattttcgagcgcgtggcccgcgcctacctggaatag

DBGET integrated database retrieval system