KEGG   Burkholderia sp. CCGE1002: BC1002_0655Help
Entry
BC1002_0655       CDS       T01217                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bge  Burkholderia sp. CCGE1002
Pathway
bge00010  Glycolysis / Gluconeogenesis
bge00030  Pentose phosphate pathway
bge00051  Fructose and mannose metabolism
bge00052  Galactose metabolism
bge00230  Purine metabolism
bge00500  Starch and sucrose metabolism
bge00520  Amino sugar and nucleotide sugar metabolism
bge00521  Streptomycin biosynthesis
bge01100  Metabolic pathways
bge01110  Biosynthesis of secondary metabolites
bge01120  Microbial metabolism in diverse environments
bge01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bge00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1002_0655
   00030 Pentose phosphate pathway
    BC1002_0655
   00051 Fructose and mannose metabolism
    BC1002_0655
   00052 Galactose metabolism
    BC1002_0655
   00500 Starch and sucrose metabolism
    BC1002_0655
   00520 Amino sugar and nucleotide sugar metabolism
    BC1002_0655
  Nucleotide metabolism
   00230 Purine metabolism
    BC1002_0655
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BC1002_0655
Enzymes [BR:bge01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BC1002_0655
    5.4.2.8  phosphomannomutase
     BC1002_0655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADG14754
UniProt: D5WCX5
Position
1:727405..728799
Genome map
AA seq 464 aa AA seqDB search
MISKSIFKAYDIRGVIGKTLDADAARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELIGA
LSDGLRAAGVDVVNVGMVPTPVGYFAASVPLKLAGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGEQILALHQRIVDENFADGNGSYTEYDIADAYLERIASDVKLARPIKIVVDT
GNGVAGGLAPKLFKKLGCELVELFTEVDGNFPNHHPDPAHPENLEDVIRALKETDAEIGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNKGAQIIYDVKCTRNLAKWVKDKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILTRVADP
SALLNSLPNSHSTPELQLKLEEGENFELIARLQQNAKFTGADNVVKIDGLRVEYPDGFGL
ARSSNTTPVVVMRFEADNDAALKRIQDDFRRVILAEKADAKLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctccaaatcgattttcaaggcatatgacattcgtggcgtcattggcaagacgctc
gacgccgacgccgcgcgttccatcggccgcgccttcggcagcgaagtgcgcgcgcagggc
ggcgacgcggtcgtagtcgcgcgcgacgggcgcctgtcgggccccgaactgatcggcgcg
ctgtccgacggcctgcgtgcggccggcgtcgacgtcgtgaacgtgggtatggtgcccacg
ccggtcggctacttcgcggcgagcgtaccgttgaagctggcgggcggcgagcgccgcgtc
gactcgtgcatcgtcgtgaccggcagccataatccgccggactacaacggcttcaagatg
gtgttgcgcggcgcggccatttacggcgagcagatcctcgcactgcatcagcgcatcgtc
gatgagaacttcgccgacggtaacggcagctacaccgaatacgacatcgccgacgcctat
ctcgagcgcatcgcgagcgacgtgaagctcgcgcgtccgatcaagatcgtcgtcgatacc
ggcaacggcgtggccggcggcctcgcaccgaagttgttcaagaagctcggctgcgaactg
gtcgaactgttcaccgaagtcgacggcaacttcccgaatcaccacccggacccggcgcac
ccggagaacctcgaagacgtgattcgcgcgctgaaggaaacggatgcggaaatcggcttc
gcgttcgacggcgacggcgaccgcctcggcgtcgtcaccaaggacggccagatcatctac
ccggaccgtcagctgatgctgttcgccgaagaagtgctgtcgcgcaacaagggcgcgcag
atcatctacgacgtcaagtgcacgcgcaatctcgcgaagtgggtcaaggacaagggcggc
gagccgctgatgtggaagaccggccactcgctcgtgaaggcgaagctgcgcgaaaccggc
gcgccgctggcgggtgaaatgagcggccacgtgttcttcaaggaccgctggtatggtttc
gacgacggcctctacaccggcgcgcgtctgctcgagatcctcacgcgcgtcgccgacccg
agcgcgctgctgaactcgctgccgaactcgcactccacgcccgagctgcaactcaagctc
gaggaaggcgagaacttcgagctgatcgcgcgtttgcagcagaacgcgaagttcaccggc
gcggacaacgtcgtgaagatcgacggtctgcgcgtcgaatatccggacggcttcggcctc
gcgcgttcgtcgaacacgacgccggtcgtcgtaatgcgtttcgaagccgacaacgacgcg
gcgctcaaacgcatccaggacgacttccgccgcgtgattctcgccgagaaggccgatgcg
aaattgccgttctga

DBGET integrated database retrieval system